Rv2918c (glnD)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: [protein-PII] uridylyltransferase
- REFSEQ: PII uridylyl-transferase
- PATRIC: [Protein-PII] uridylyltransferase (EC 2.7.7.59)
- TUBERCULIST: Probable [protein-PII] uridylyltransferase GlnD (PII uridylyl- transferase) (uridylyl removing enzyme) (UTASE)
- NCBI: Probable [protein-PII] uridylyltransferase GlnD (PII uridylyl-transferase) (uridylyl removing enzyme) (UTASE)
- updated information (H37Rv4):
  - gene name: glnD
  - function:
  - reference: Read (2007) PMC1913930
Type: Not Target
Start: 3228254
End: 3230680
Operon:

Trans-membrane region:
Role: I.D.1 - Glutamate family
GO terms:
- GO:0070566 - adenylyltransferase activity (Uniprot)
- GO:0016787 - hydrolase activity (Uniprot)
- GO:0016779 - nucleotidyltransferase activity (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0008773 - [protein-PII] uridylyltransferase activity (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
- GO:0006807 - nitrogen compound metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0003824 - catalytic activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on glnD:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.096 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MEAESPCAASDLAVARRELLSGNHRELDPVGLRQTWLDLHESWLIDKADEIGIADASGFAIVGVGGLGRRELLPYSDLDVLLLHDGKPADILRPVADRLW
YPLWDANIRLDHSVRTVSEALTIANSDLMAALGMLEARHIAGDQQLSFALIDGVRRQWRNGIRSRMGELVEMTYARWRRCGRIAQRAEPDLKLGRGGLRD
VQLLDALALAQLIDRHGIGHTDLPAGSLDGAYRTLLDVRTELHRVSGRGRDHLLAQFADEISAALGFGDRFDLARTLSSAGRTIGYHAEAGLRTAANALP
RRGISALVRRPKRRPLDEGVVEYAGEIVLARDAEPEHDPGLVLRVAAASADTGLPIGAATLSRLAASVPDLPTPWPQEALDDLLVVLSAGPTTVATIEAL
DRTGLWGRLLPEWEPIRDLPPRDVAHKWTVDRHVVETAVHAAPLATRVARPDLLALGALLHDIGKGRGTDHSVLGAELVIPVCTRLGLSPPDVRTLSKLV
RHHLLLPITATRRDLNDPKTIEAVSEALGGDPQLLEVLHALSEADSKATGPGVWSDWKASLVDDLVRRCRMVMAGESLPQAEPTAPHYLSLAADHGVHVE
ISPRDGERIDAVIVAPDERGLVSKAAAVLALNSLRVHSASVNVHQGVAITEFVVSPLFGSPPAAELVRQQFVGALNGDVDVLGMLQKRDSDAASLVSARA
GDVQAGVPVTRTAAPPRILWLDTAAPAKLILEVRAMDRAGLLALLAGALEGAGAGIVWAKVNTFGSTAADVFCVTVPAELDARAAVEQHLLEVLGASVDV
VVDEPVGD

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.676650; 8 non-insertions in a row out of 26 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 26 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 26 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 27 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 27 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0576 (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Operon Rv2919c	shahanup86	IEP		Coexpression(Functional Linkage) A. Bandyopadhyay, A. Arora et al. Expression and molecular characterization of the Mycobacterium tuberculosis PII protein. J. Biochem. 2010
Citation	The role of GlnD in ammonia assimilation in Mycobacterium tuberculosis. R. Read, CA. Pashley et al. Tuberculosis (Edinburgh, Scotland) 2007	priti.priety	IEP	17303474	Coexpression(Functional Linkage)
Interaction	Operon Rv2919c	priti.priety	IEP		Coexpression(Functional Linkage) R. Read, CA. Pashley et al. The role of GlnD in ammonia assimilation in Mycobacterium tuberculosis. Tuberculosis (Edinburgh, Scotland) 2007
Citation	Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. K. Raman & N. Chandra BMC Microbiol. 2008	priti.priety	IEP	19105810	Coexpression(Functional Linkage)
Interaction	Operon Rv2919c	priti.priety	IEP		Coexpression(Functional Linkage) K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	Operon Rv2919c	shahanup86	IEP		Coexpression(Functional Linkage) R. Read, CA. Pashley et al. The role of GlnD in ammonia assimilation in Mycobacterium tuberculosis. Tuberculosis (Edinburgh, Scotland) 2007

TB Genome Annotation Portal