TB Genome Annotation Portal

Rv2914c (pknI)

Amino Acid Sequence

MALASGVTFAGYTVVRMLGCSAMGEVYLVQHPGFPGWQALKVLSPAMAADDEFRRRFQRETEVAARLFHPHILEVHDRGEFDGQLWIAMDYVDGIDATQH
MADRFPAVLPVGEVLAIVTAVAGALDYAHQRGLLHRDVNPANVVLTSQSAGDQRILLADFGIASQPSYPAPELSAGADVDGRADQYALALTAIHLFAGAP
PVDRSHTGPLQPPKLSAFRPDLARLDGVLSRALATAPADRFGSCREFADAMNEQAGVAIADQSSGGVDASEVTAAAGEEAYVVDYPAYGWPEAVDCKEPS
ARAPAPAAPTPQRRGSMLQSAAGVLARRLDNFSTATKAPASPTRRRPRRILVGAVAVLLLAGLFAVGIVIGRKTNTTATEVARPPTSGSAVPSAPTTTVA
VTAPVPLDGTYRIEIQRSKQTYDYTPTPQPPDVNTWWAFRTSCTPTECLAAATMLDDNDHTQAKTPPVRPFLMQFGEGQWKSRPETVQFPCVGPNGSPST
QATTQLLALRPQPQGDLVGEMVVTVHSNECGQQGAVIRIPAVASRSGDLPPAVTVPDPATIPDTPDTTSTATLTPPTTTAPGPGR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2914c/pknI, gene len: 1757 bp, num TA sites: 27
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathYES (LFC=-1.3)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.086)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-1.09)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.45 (0.72)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2914c/pknIRv3416/whiB32.68
    Rv2914c/pknIRv0818/glnR1.7
    Rv2914c/pknIRv1219c/--1.02


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2914c (pknI)

    PropertyValueCreatorEvidencePMIDComment
    InteractionSignaling Rv2916cpriti.prietyIDAAffinity purification (Physical interaction)
    A. Singh, Y. Singh et al. Protein kinase I of Mycobacterium tuberculosis: cellular localization and expression during infection of macrophage-like cells. Tuberculosis (Edinburgh, Scotland) 2006
    CitationCloning, overexpression, and characterization of a serine/threonine protein kinase pknI from Mycobacterium tuberculosis H37Rv. R. Gopalaswamy, PR. Narayanan et al. Protein Expr. Purif. 2004priti.prietyIDA15177288Affinity purification (Physical interaction)
    InteractionSignaling Rv2913cpriti.prietyIDAAffinity purification (Physical interaction)
    R. Gopalaswamy, PR. Narayanan et al. Cloning, overexpression, and characterization of a serine/threonine protein kinase pknI from Mycobacterium tuberculosis H37Rv. Protein Expr. Purif. 2004
    InteractionSignaling Rv2916cpriti.prietyIDAAffinity purification (Physical interaction)
    R. Gopalaswamy, PR. Narayanan et al. Cloning, overexpression, and characterization of a serine/threonine protein kinase pknI from Mycobacterium tuberculosis H37Rv. Protein Expr. Purif. 2004
    CitationThe serine/threonine protein kinase PknI controls the growth of Mycobacterium tuberculosis upon infection. R. Gopalaswamy, S. Narayanan et al. FEMS Microbiol. Lett. 2009priti.prietyIDA19341393Affinity purification (Physical interaction)
    InteractionSignaling Rv2913cpriti.prietyIDAAffinity purification (Physical interaction)
    R. Gopalaswamy, S. Narayanan et al. The serine/threonine protein kinase PknI controls the growth of Mycobacterium tuberculosis upon infection. FEMS Microbiol. Lett. 2009
    InteractionSignaling Rv2916cpriti.prietyIDAAffinity purification (Physical interaction)
    R. Gopalaswamy, S. Narayanan et al. The serine/threonine protein kinase PknI controls the growth of Mycobacterium tuberculosis upon infection. FEMS Microbiol. Lett. 2009
    CitationProtein kinase I of Mycobacterium tuberculosis: cellular localization and expression during infection of macrophage-like cells. A. Singh, Y. Singh et al. Tuberculosis (Edinburgh, Scotland) 2006priti.prietyIDA16256441Affinity purification (Physical interaction)
    InteractionSignaling Rv2913cpriti.prietyIDAAffinity purification (Physical interaction)
    A. Singh, Y. Singh et al. Protein kinase I of Mycobacterium tuberculosis: cellular localization and expression during infection of macrophage-like cells. Tuberculosis (Edinburgh, Scotland) 2006
    InteractionOperon Rv2913cashwinigbhatNASCo-expression (Functional linkage)
    authors,A. Zelikovski,J. Abu-Dalu,I. Urca Meso-appendicular testis. Br J Urol 1975
    InteractionOperon Rv2913cashwinigbhatNASCo-expression (Functional linkage)
    Y. Av-Gay,M. Everett The eukaryotic-like Ser/Thr protein kinases of Mycobacterium tuberculosis. Trends Microbiol. 2000
    InteractionOperon Rv2913cashwinigbhatNASCo-expression (Functional linkage)
    R. Gopalaswamy, S. Narayanan et al. The serine/threonine protein kinase PknI controls the growth of Mycobacterium tuberculosis upon infection. FEMS Microbiol. Lett. 2009
    InteractionOperon Rv2913cashwinigbhatNASCo-expression (Functional linkage)
    authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978

    Comments