TB Genome Annotation Portal

Rv2913c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: deacetylase
  • REFSEQ: D-amino acid aminohydrolase
  • PATRIC: N-acyl-D-glutamate amidohydrolase
  • TUBERCULIST: Possible D-amino acid aminohydrolase (D-amino acid hydrolase)
  • NCBI: Possible D-amino acid aminohydrolase (D-amino acid hydrolase)
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 3219863
• End: 3221698
• Operon:


• Trans-membrane region:
  
• Role: I.A.2 - Amino acids and amines
• GO terms:
  • GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3GIQ	37%	Bordetella bronchiseptica	Crystal structure of N-acyl-D-Glutamate Deacylase from Bordetella Bronchiseptica complexed with zinc and phosphonate inhibitor, a mimic of the reaction tetrahedral intermediate.
  3GIP	37%	Bordetella bronchiseptica	Crystal structure of N-acyl-D-Glutamate Deacylase from Bordetella Bronchiseptica complexed with zinc, acetate and formate ions.

• Links to additional information on Rv2913c:
  • KEGG - nucleotide and amino acid sequences of gene
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.877 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MLAWRQLNDLEETVTYDVIIRDGLWFDGTGNAPLTRTLGIRDGVVATVAAGALDETGCPEVVDAAGKWVVPGFIDVHTHYDAEVLLDPGLRESVRHGVTT
VLLGNCSLSTVYANSEDAADLFSRVEAVPREFVLGALRDNQTWSTPAEYIEAIDALPLGPNVSSLLGHSDLRTAVLGLDRATDDTVRPTEAELAKMAKLL
DEALEAGMLGMSGMDAAIDKLDGDRFRSRALPSTFATWRERRKLISVLRHRGRILQSAPDVDNPVSALLFFLASSRIFNRRKGVRMSMLVSADAKSMPLA
VHVFGLGTRVLNKLLGSQVRFQHLPVPFELYSDGIDLPVFEEFGAGTAALHLRDQLQRNELLADRSYRRSFRREFDRIKLGPSLWHRDFHDAVIVECPDK
SLIGKSFGAIADERGLHPLDAFLDVLVDNGERNVRWTTIVANHRPNQLNKLAAEPSVHMGFSDAGAHLRNMAFYNFGLRLLKRARDADRAGQPFLSIERA
VYRLTGELAEWFGIGAGTLRQGDRADFAVIDPTHLDESVDGYHEEAVPYYGGLRRMVNRNDATVVATGVGGTVVFRGGQFGGQFRDGYGQNVKSGRYLRA
GELGAALSRSA

Additional Information