TB Genome Annotation Portal

Rv2866 (relG)

Amino Acid Sequence

VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDHRADIYRR
(Nucleotide sequence available on KEGG)

Additional Information

relE2
http://www.ncbi.nlm.nih.gov/pubmed/20061486

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2866/relG, gene len: 263 bp, num TA sites: 6
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.02)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.861)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.18)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.4 (0.51)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2866/relGRv0023/-1.88
    Rv2866/relGRv3260c/whiB21.11
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2866 (relG)

    PropertyValueCreatorEvidencePMIDComment
    InteractionInhibits Rv2865akvsangliIDASpectrophotometric assay
    SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
    CitationThree Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. SB. Korch, H. Contreras et al. J. Bacteriol. 2008akvsangliIDA19114484Spectrophotometric assay
    InteractionInhibits Rv2865akvsangliIDASpectrophotometric assay
    SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
    InteractionRegulatory Rv2053cshahanup86TASCo-expression (Functional linkage)
    authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
    InteractionRegulatory Rv2052cshahanup86TASCo-expression (Functional linkage)
    authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
    InteractionRegulatory Rv0616cakankshajain.21IEPCo-expression (Functional linkage)
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009jlew20011113RelE homolog, Toxic when expressed in Msmeg, rescued by antitoxin (Rv2865)
    SymbolrelGjlewEach pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself.
    authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He Characterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. PLoS ONE 2010
    CitationCharacterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He PLoS ONE 2010jlew20498855Each pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself.
    SymbolrelE2jlewRelE2 overexpression increased bacterial survival rates in the presence of rifampin in vitro, while deletion significantly decreased survival rates. Strikingly, deletion of this toxin had no discernible effect on the level of persisters seen in rifampin-treated mice.. Each toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin.
    authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
    CitationThe three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. authors,R. Singh,CE. Barry,HI. Boshoff J. Bacteriol. 2010jlew20061486RelE2 overexpression increased bacterial survival rates in the presence of rifampin in vitro, while deletion significantly decreased survival rates. Strikingly, deletion of this toxin had no discernible effect on the level of persisters seen in rifampin-treated mice.. Each toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin.
    SymbolrelGjlewOverexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ
    SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
    CitationThree Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. SB. Korch, H. Contreras et al. J. Bacteriol. 2008jlew19114484Overexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ
    SymbolRelE2jlewWe report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
    CitationKilling activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009jlew19016878We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    Otherstart:3177822rslaydenMTV006.18c CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 290, E():3.6e-16, (54.1% identity in 85 aa overlap)
    Otherstop:3178085rslaydenMTV006.18c CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 290, E():3.6e-16, (54.1% identity in 85 aa overlap)
    Otherstrand:+rslaydenMTV006.18c CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (97 aa), FASTA scores: opt: 290, E():3.6e-16, (54.1% identity in 85 aa overlap)
    Otherstart:3177822rslaydenConserved hypothetical protein, similar to O50461
    Otherstop:3178085rslaydenConserved hypothetical protein, similar to O50461
    Otherstrand:+rslaydenConserved hypothetical protein, similar to O50461
    Otherstart:3177822rslaydenRv1246c
    Otherstop:3178085rslaydenRv1246c
    Otherstrand:+rslaydenRv1246c

    Comments