Rv2850c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: cobaltochelatase subunit
- REFSEQ: magnesium chelatase
- PATRIC: ChlI component of cobalt chelatase involved in B12 biosynthesis / ChlD component of cobalt chelatase involved in B12 biosynthesis
- TUBERCULIST: Possible magnesium chelatase
- NCBI: Possible magnesium chelatase
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 3158165
End: 3160054
Operon:

Trans-membrane region:
Role: IV.K - Chelatases
GO terms:
- GO:0016887 - ATPase activity (Uniprot)
- GO:0005524 - ATP binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2X31	49%	RHODOBACTER CAPSULATUS	Modelling of the complex between subunits BchI and BchD of magnesium chelatase based on single-particle cryo-EM reconstruction at 7.5 ang
1G8P	49%	Rhodobacter capsulatus	CRYSTAL STRUCTURE OF BCHI SUBUNIT OF MAGNESIUM CHELATASE
6L8D	43%	Synechocystis sp. PCC 6803 substr. Kazusa	Hexameric structure of the ATPase subunit of magnesium chelatase
2X31	39%	RHODOBACTER CAPSULATUS	Modelling of the complex between subunits BchI and BchD of magnesium chelatase based on single-particle cryo-EM reconstruction at 7.5 ang

Links to additional information on Rv2850c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSVATGSTETGLVELPLGATEDRVVGSLDLQRVMRDGEHAFSPGLLARA
HGGVLYVDEVNLLHDHLVDILLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVQASRDIDVRVQVIRRRMAYEADPDAFVA
RYADADAELAHRIAAARATVDDVVLGDNELRRIAALCAAFDVDGMRADLVVARTAAAHAAWRGVRTVEEQDIRAAAELALPHRRRRDPFDDHGIDRDQLD
EALALASVDPEPEPDPPGGGQSANEPASQPNSRSKSTEPGAPSSMGDDPPRPASPRLRSSPRPSAPPSKIFRTRALRVPGVGTGAPGRRSRARNASGSVV
AAAEVSDPDAHGLHLFATLLAAGERAFGAGPLRPWPDDVRRAIREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLRDAYQRRDKVAVITFRQHEAT
LLLSPTSSAHIAGRRLARFSTGGKTPLAEGLLAARALIIREKVRDRARRPLVVVLTDGRATAGPDPLGRSRTAAAGLVAEGAAAVVVDCETSYVRLGLAA
QLARQLGAPVVRLEQLHADYLVHAVRGVA

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.980500; 9 non-insertions in a row out of 17 sites
Uncertain	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.872650; 6 non-insertions in a row out of 17 sites
Uncertain	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.202450; 4 non-insertions in a row out of 17 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.636100; 6 non-insertions in a row out of 17 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.620450; 6 non-insertions in a row out of 17 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.35
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1816 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. JH. Lee, PC. Karakousis et al. J. Bacteriol. 2008	yashabhasin	IEP	17993538	Co-expression (Functional linkage)
Interaction	Regulatory Rv2710	yashabhasin	IEP		Co-expression (Functional linkage) JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Interaction	RegulatedBy Rv2710	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Citation	Genetic Requirements for the Survival of Tubercle Bacilli in Primates. NK. Dutta,S. Mehra,PJ. Didier,CJ. Roy,LA. Doyle,X. Alvarez,M. Ratterree,NA. Be,G. Lamichhane,SK. Jain,MR. Lacey,AA. Lackner,D. Kaushal The Journal of infectious diseases 2010	mwilliams		20394526	Possible cobalt/magnesium chelatase. Strongly expressed during logarithmic and stationary phase growth. Tn-mutant of this gene is attenuated growth in Indian rhesus macaques
Citation	Genomic DNA standards for gene expression profiling in Mycobacterium tuberculosis. authors,AM. Talaat,ST. Howard,W. Hale,R. Lyons,H. Garner,SA. Johnston Nucleic Acids Res. 2002	mwilliams		12384606	Possible cobalt/magnesium chelatase. Strongly expressed during logarithmic and stationary phase growth. Tn-mutant of this gene is attenuated growth in Indian rhesus macaques

TB Genome Annotation Portal