TB Genome Annotation Portal

Rv2841c (nusA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: transcription elongation protein nusA
  • REFSEQ: transcription elongation factor NusA
  • PATRIC: Transcription termination protein NusA
  • TUBERCULIST: Probable N utilization substance protein A NusA
  • NCBI: Probable N utilization substance protein A NusA
  • updated information (H37Rv4):
    • gene name: nusA
    • function:
    • reference:
• Type: Not Target
• Start: 3148385
• End: 3149428
• Operon:


• Trans-membrane region:
  
• Role: II.A.7 - RNA synthesis, RNA modification and DNA transcription
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0031564 - transcription antitermination (Uniprot)
  • GO:0031554 - regulation of DNA-templated transcription, termination (Uniprot)
  • GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
  • GO:0006353 - DNA-templated transcription, termination (Uniprot)
  • GO:0006351 - transcription, DNA-templated (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0003723 - RNA binding (Uniprot)
  • GO:0003700 - DNA binding transcription factor activity (Uniprot)
  • GO:0003676 - nucleic acid binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 1k0r, 2asb, 2atw
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2ATW	100%	Mycobacterium tuberculosis	Structure of a Mycobacterium tuberculosis NusA-RNA complex
  2ASB	100%	Mycobacterium tuberculosis	Structure of a Mycobacterium tuberculosis NusA-RNA complex
  1K0R	100%	Mycobacterium tuberculosis	Crystal Structure of Mycobacterium tuberculosis NusA
  1L2F	39%	Thermotoga maritima	Crystal structure of NusA from Thermotoga maritima: a structure-based role of the N-terminal domain
  1HH2	39%	THERMOTOGA MARITIMA	Crystal structure of NusA from Thermotoga maritima
  5LM9	39%	Escherichia coli K-12	Structure of E. coli NusA
  4MTN	37%	Planctomyces limnophilus	Crystal structure of transcription termination factor NusA from Planctomyces limnophilus DSM 3776
  6J9E	35%	Xanthomonas oryzae pv. oryzae PXO99A	Cryo-EM structure of Xanthomonos oryzae transcription elongation complex with NusA and the bacteriophage protein P7

• Links to additional information on nusA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -7.279 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MNIDMAALHAIEVDRGISVNELLETIKSALLTAYRHTQGHQTDARIEIDRKTGVVRVIARETDEAGNLISEWDDTPEGFGRIAATTARQVMLQRFRDAEN
ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI
ADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRGDAPPPPPGQPEPGVSRGMAHDR

Additional Information