TB Genome Annotation Portal

Rv2833c (ugpB)

Amino Acid Sequence

MDPLNRRQFLALAAAAAGVTAGCAGMGGGGSVKSGSGPIDFWSSHPGQSSAAERELIGRFQDRFPTLSVKLIDAGKDYDEVAQKFNAALIGTDVPDVVLL
DDRWWFHFALSGVLTALDDLFGQVGVDTTDYVDSLLADYEFNGRHYAVPYARSTPLFYYNKAAWQQAGLPDRGPQSWSEFDEWGPELQRVVGAGRSAHGW
ANADLISWTFQGPNWAFGGAYSDKWTLTLTEPATIAAGNFYRNSIHGKGYAAVANDIANEFATGILASAVASTGSLAGITASARFDFGAAPLPTGPDAAP
ACPTGGAGLAIPAKLSEERKVNALKFIAFVTNPTNTAYFSQQTGYLPVRKSAVDDASERHYLADNPRARVALDQLPHTRTQDYARVFLPGGDRIISAGLE
SIGLRGADVTKTFTNIQKRLQVILDRQIMRKLAGHG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.980000;
11 non-insertions in a row out of 19 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 19 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 19 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
5 non-insertions in a row out of 19 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 19 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.16
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2833c (ugpB)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:GLYC3Pabc sn-Glycerol 3-phosphate transport via ABC system - ISSnjamshidiISS12657046Believed to be importer exp evidence PMID: 12657046. See also PMID: 10978546. Cole et al: Tuberculosis and the Tubercle Bacillus chapter 24 - unknown mechism. high affinity for basic amino acids; unknown mechanism, for current version assume permease/diffusion transport
    authors,CM. Sassetti,DH. Boyd,EJ. Rubin Genes required for mycobacterial growth defined by high density mutagenesis. Mol. Microbiol. 2003
    CitationThe ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. authors,M. Braibant,P. Gilot,J. Content FEMS Microbiol. Rev. 2000njamshidiISS10978546|12657046Believed to be importer exp evidence PMID: 12657046. See also PMID: 10978546. Cole et al: Tuberculosis and the Tubercle Bacillus chapter 24 - unknown mechism. high affinity for basic amino acids; unknown mechanism, for current version assume permease/diffusion transport
    TermTBRXN:GLYC3Pabc sn-Glycerol 3-phosphate transport via ABC system - ISSnjamshidiISS12657046Believed to be importer exp evidence PMID: 12657046. See also PMID: 10978546. Cole et al: Tuberculosis and the Tubercle Bacillus chapter 24 - unknown mechism. high affinity for basic amino acids; unknown mechanism, for current version assume permease/diffusion transport
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    CitationGenes required for mycobacterial growth defined by high density mutagenesis. authors,CM. Sassetti,DH. Boyd,EJ. Rubin Mol. Microbiol. 2003njamshidiIPI12657046Believed to be importer exp evidence PMID: 12657046. See also PMID: 10978546. Cole et al: Tuberculosis and the Tubercle Bacillus chapter 24 - unknown mechism. high affinity for basic amino acids; unknown mechanism, for current version assume permease/diffusion transport
    TermTBRXN:GLYC3Pabc sn-Glycerol 3-phosphate transport via ABC system - IPInjamshidiIPI12657046Believed to be importer exp evidence PMID: 12657046. See also PMID: 10978546. Cole et al: Tuberculosis and the Tubercle Bacillus chapter 24 - unknown mechism. high affinity for basic amino acids; unknown mechanism, for current version assume permease/diffusion transport
    authors,CM. Sassetti,DH. Boyd,EJ. Rubin Genes required for mycobacterial growth defined by high density mutagenesis. Mol. Microbiol. 2003
    CitationThe ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. authors,M. Braibant,P. Gilot,J. Content FEMS Microbiol. Rev. 2000njamshidiIPI10978546|12657046Believed to be importer exp evidence PMID: 12657046. See also PMID: 10978546. Cole et al: Tuberculosis and the Tubercle Bacillus chapter 24 - unknown mechism. high affinity for basic amino acids; unknown mechanism, for current version assume permease/diffusion transport
    TermTBRXN:GLYC3Pabc sn-Glycerol 3-phosphate transport via ABC system - IPInjamshidiIPI12657046Believed to be importer exp evidence PMID: 12657046. See also PMID: 10978546. Cole et al: Tuberculosis and the Tubercle Bacillus chapter 24 - unknown mechism. high affinity for basic amino acids; unknown mechanism, for current version assume permease/diffusion transport
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    CitationGenes required for mycobacterial growth defined by high density mutagenesis. authors,CM. Sassetti,DH. Boyd,EJ. Rubin Mol. Microbiol. 2003njamshidiISS12657046Believed to be importer exp evidence PMID: 12657046. See also PMID: 10978546. Cole et al: Tuberculosis and the Tubercle Bacillus chapter 24 - unknown mechism. high affinity for basic amino acids; unknown mechanism, for current version assume permease/diffusion transport
    SymbolUgpBjlewContains a functional tat sequence. Test for functional tat sequences using a BlaC reporter. 13 identified.
    JA. McDonough, JR. McCann et al. Identification of functional Tat signal sequences in Mycobacterium tuberculosis proteins. J. Bacteriol. 2008
    CitationIdentification of functional Tat signal sequences in Mycobacterium tuberculosis proteins. JA. McDonough, JR. McCann et al. J. Bacteriol. 2008jlew18658266Contains a functional tat sequence. Test for functional tat sequences using a BlaC reporter. 13 identified.

    Comments