TB Genome Annotation Portal

Rv2832c (ugpC)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: sn-glycerol 3-phosphate transporter ATP-binding protein
  • REFSEQ: sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter UGPC
  • PATRIC: Glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (TC 3.A.1.1.3)
  • TUBERCULIST: Probable Sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter UgpC
  • NCBI: Probable Sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter UgpC
  • updated information (H37Rv4):
    • gene name: ugpC
    • function:
    • reference:
• Type: Not Target
• Start: 3138099
• End: 3139181
• Operon:


• Trans-membrane region:
  
• Role: III.A.3 - Carbohydrates, organic acids and alcohols
• GO terms:
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • PI[c] -> GL3P[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1G29	48%	Thermococcus litoralis	MALK
  1VCI	47%	Pyrococcus horikoshii	Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3 complexed with ATP
  1V43	47%	Pyrococcus horikoshii	Crystal Structure of ATPase subunit of ABC Sugar Transporter
  2D62	47%	Pyrococcus horikoshii	Crystal structure of multiple sugar binding transport ATP-binding protein
  4XTC	45%	Sphingomonas sp. A1	Crystal structure of bacterial alginate ABC transporter in complex with alginate pentasaccharide-bound periplasmic protein
  4XIG	45%	Sphingomonas sp. A1	Crystal structure of bacterial alginate ABC transporter determined through humid air and glue-coating method
  4TQV	45%	Sphingomonas sp.	Crystal structure of a bacterial ABC transporter involved in the import of the acidic polysaccharide alginate
  4TQU	45%	Sphingomonas sp.	Crystal structure of a bacterial ABC transporter involved in the import of the acidic polysaccharide alginate
  2YYZ	44%	Thermotoga maritima	Crystal structure of Sugar ABC transporter, ATP-binding protein
  4KI0	43%	Escherichia coli	Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose

• Links to additional information on ugpC:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.09 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MANVQYSAVTQRYPGADAPTVDNLDLDIADGEFLVLVGPSGCGKSTTLRVLAGLEPIESGRISIGDVDVTHLPPRARDVAMVFQNYALYPNMTVAANMGF
ALRNAGMSRADTRRRVLEVADMLELTDLLDRKPAKLSGGQRQRVAMGRAIVRRPRVFCMDEPLSNLDAKLRVSTRSQISGLQRRLGTTTVYVTHDQVEAM
TMGDRVAVLKDGVLQQVDTPRALYDDPVNTFVATFIGAPAMNLIDAAVAHGVVRAPDLAIPVPDPAAERVLVGVRPESWDVASIGTPGSLTVHVELVEEL
GFESFVYATPVDQRGWSSRAPRIVFRTDRRTAVRVGESLAIVPHSQEVRLFNSRTETRLR

Additional Information