TB Genome Annotation Portal

Rv2758c (vapB21)

Amino Acid Sequence

MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWRDGHPENTA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Too-Short Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
1 non-insertions in a row out of 5 sites
Too-Short Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
1 non-insertions in a row out of 5 sites
Too-Short Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
1 non-insertions in a row out of 5 sites
Too-Short minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: -1.000000;
3 non-insertions in a row out of 5 sites
Too-Short minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: -1.000000;
2 non-insertions in a row out of 5 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 3.24
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2758c (vapB21)

    PropertyValueCreatorEvidencePMIDComment
    InteractionInhibits Rv2757cvizhi.gurusamyIEPCo-expression (Functional linkage)
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    InteractionInhibits Rv2757cvizhi.gurusamyIEPCo-expression (Functional linkage)
    authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
    CitationToxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. authors,DP. Pandey,K. Gerdes Nucleic Acids Res. 2005vizhi.gurusamyIEP15718296Co-expression (Functional linkage)
    InteractionInhibits Rv2757cvizhi.gurusamyIEPCo-expression (Functional linkage)
    authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
    CitationThe PIN-domain toxin-antitoxin array in mycobacteria. authors,VL. Arcus,PB. Rainey,SJ. Turner Trends Microbiol. 2005vizhi.gurusamyIEP15993073Co-expression (Functional linkage)
    InteractionInhibits Rv2757cvizhi.gurusamyIEPCo-expression (Functional linkage)
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    SymbolVapB21jlewWe report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
    CitationKilling activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009jlew19016878We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    Otherstop:3070849rslaydenMTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565
    Otherstrand:+rslaydenMTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565
    SymbolVap BC-21rslaydenRv1113
    Otherstart:3070583rslaydenRv1113
    Otherstop:3070849rslaydenRv1113
    Otherstrand:+rslaydenRv1113
    SymbolVap BC-21rslaydenMTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
    Otherstart:3070583rslaydenMTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
    Otherstop:3070849rslaydenMTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
    Otherstrand:+rslaydenMTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
    SymbolVap BC-21rslaydenConserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P95008
    Otherstart:3070583rslaydenConserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P95008
    Otherstop:3070849rslaydenConserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P95008
    Otherstrand:+rslaydenConserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P95008
    SymbolVap BC-21rslaydenRv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65%identity in 45 aa overlap); Q10771
    Otherstart:3070583rslaydenRv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65%identity in 45 aa overlap); Q10771
    Otherstop:3070849rslaydenRv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65%identity in 45 aa overlap); Q10771
    Otherstrand:+rslaydenRv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65%identity in 45 aa overlap); Q10771
    SymbolVap BC-21rslaydenYF60_MYCTU
    Otherstart:3070583rslaydenYF60_MYCTU
    Otherstop:3070849rslaydenYF60_MYCTU
    Otherstrand:+rslaydenYF60_MYCTU
    SymbolVap BC-21rslaydenRv1560
    Otherstart:3070583rslaydenRv1560
    Otherstop:3070849rslaydenRv1560
    Otherstrand:+rslaydenRv1560
    SymbolVap BC-21rslaydenMT1611
    Otherstart:3070583rslaydenMT1611
    Otherstop:3070849rslaydenMT1611
    Otherstrand:+rslaydenMT1611
    SymbolVap BC-21rslaydenMTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565
    Otherstart:3070583rslaydenMTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565

    Comments