TB Genome Annotation Portal

Rv2747 (argA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: amino-acid N-acetyltransferase
  • REFSEQ: N-acetylglutamate synthase
  • PATRIC: Acetyltransferase GNAT family
  • TUBERCULIST: Probable L-glutamate alpha-N-acetyltranferase ArgA (alpha-N-acetylglutamate synthase)
  • NCBI: Probable L-glutamate alpha-N-acetyltranferase ArgA (alpha-N-acetylglutamate synthase)
  • updated information (H37Rv4):
    • gene name: argA
    • function:
    • reference:
• Type: Essential
• Start: 3059262
• End: 3059786
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0103045 - methione N-acyltransferase activity (Uniprot)
  • GO:0051289 - protein homotetramerization (Uniprot)
  • GO:0042803 - protein homodimerization activity (Uniprot)
  • GO:0042450 - arginine biosynthetic process via ornithine (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0008080 - N-acetyltransferase activity (Uniprot)
  • GO:0006526 - arginine biosynthetic process (Uniprot)
  • GO:0004042 - acetyl-CoA:L-glutamate N-acetyltransferase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ACCOA[c] + GLU[c] <=> COA[c] + NAGLU[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5YGE	100%	Mycobacterium tuberculosis	ArgA complexed with AceCoA and glutamate
  6ADD	99%	Mycobacterium tuberculosis H37Rv	The crystal structure of Rv2747 from Mycobacterium tuberculosis in complex with CoA and NLQ
  5YO2	99%	Mycobacterium tuberculosis H37Rv	The crystal structure of Rv2747 from Mycobacterium tuberculosis in complex with Acetyl CoA and L-Arginine

• Links to additional information on argA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -4.283 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VTERPRDCRPVVRRARTSDVPAIKQLVDTYAGKILLEKNLVTLYEAVQEFWVAEHPDLYGKVVGCGALHVLWSDLGEIRTVAVDPAMTGHGIGHAIVDRL
LQVARDLQLQRVFVLTFETEFFARHGFTEIEGTPVTAEVFDEMCRSYDIGVAEFLDLSYVKPNILGNSRMLLVL

Additional Information