Rv2745c (clgR)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: transcriptional regulator
- REFSEQ: transcriptional regulatory protein
- PATRIC: Transcriptional regulator XRE family
- TUBERCULIST: Transcriptional regulatory protein ClgR
- NCBI: Transcriptional regulatory protein ClgR
- updated information (H37Rv4):
  - gene name: clgR
  - function: regulator of Clp protease
  - reference: McGillivray et al (2015) PMID 25422323
Type: Not Target
Start: 3058193
End: 3058531
Operon:

Trans-membrane region:
Role: I.J.1 - Repressors/activators
GO terms:
- GO:1902882 - regulation of response to oxidative stress (Uniprot)
- GO:0090062 - regulation of trehalose metabolic process (Uniprot)
- GO:0085016 - dormancy exit of symbiont in host (Uniprot)
- GO:0061136 - regulation of proteasomal protein catabolic process (Uniprot)
- GO:0052170 - negative regulation by symbiont of host innate immune response (Uniprot)
- GO:0045893 - positive regulation of transcription, DNA-templated (Uniprot)
- GO:0044119 - growth of symbiont in host cell (Uniprot)
- GO:0043620 - regulation of DNA-templated transcription in response to stress (Uniprot)
- GO:0043565 - sequence-specific DNA binding (Uniprot)
- GO:0019217 - regulation of fatty acid metabolic process (Uniprot)
- GO:0010447 - response to acidic pH (Uniprot)
- GO:0009408 - response to heat (Uniprot)
- GO:0006979 - response to oxidative stress (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
5WOQ	71%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of an XRE family protein transcriptional regulator from Mycobacterium smegmatis
3F52	54%	Corynebacterium glutamicum	Crystal structure of the clp gene regulator ClgR from C. glutamicum
3F51	54%	Corynebacterium glutamicum	Crystal Structure of the clp gene regulator ClgR from Corynebacterium glutamicum
6RNZ	37%	Deinococcus deserti	Crystal structure of the N-terminal HTH DNA-binding domain of the essential repressor DdrO from radiation-resistant Deinococcus bacteria (Deinococcus deserti)
6RNX	37%	Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923)	Crystal structure of the essential repressor DdrO from radiation-resistant Deinococcus bacteria (Deinococcus deserti)
6RMQ	37%	Deinococcus deserti	Crystal structure of a selenomethionine-substituted A70M I84M mutant of the essential repressor DdrO from radiation resistant-Deinococcus bacteria (Deinococcus deserti)
6JQ1	37%	Deinococcus geothermalis DSM 11300	Crystal Structure of DdrO from Deinococcus geothermalis

Links to additional information on clgR:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.203 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTK
VVIAPVVSLAVA

(Nucleotide sequence available on KEGG)

Additional Information

ClgR - Clp regulator
McGillivray et al (2015). The Mycobacterium tuberculosis Clp Gene Regulator Is Required for in Vitro Reactivation from Hypoxia-induced Dormancy. JBC. https://pubmed.ncbi.nlm.nih.gov/25422323/

Analysis of Positive Selection in Clinical Isolates new

Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
- Moldova: 2,057 clinical isolates
- global set: 5,195 clinical isolates from 15 other countries
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	0.63 (0.01)	1.41 (0.44)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link

* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2745c/clgR, gene len: 338 bp, num TA sites: 3

condition	dataset	call	medium	method	notes
in-vitro	DeJesus 2017 mBio	non-essential	7H9	HMM	fully saturated, 14 TnSeq libraries combined
in-vitro	Sassetti 2003 Mol Micro	non-essential	7H9	TRASH	essential if hybridization ratio<0.2
in-vivo (mice)	Sassetti 2003 PNAS	non-essential	BL6 mice	TRASH	essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)	Griffin 2011 PPath	too short	M9 minimal+glycerol	Gumbel	2 replicates; Padj<0.05
in-vitro (cholesterol)	Griffin 2011 PPath	too short	M9 minimal+cholesterol	Gumbel	3 replicates; Padj<0.05
differentially essential in cholesterol	Griffin 2011 PPath	NO (LFC=-2.18)	cholesterol vs glycerol	resampling-SR	YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro	Smith 2022 eLife	non-essential	7H9	HMM	6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)	Smith 2022 eLife	non-essential	BL6 mice	HMM	6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice	Smith 2022 eLife	NO (LFC=-0.789)	in-vivo vs in-vitro	ZINB	YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)	Minato 2019 mSys	non-essential	minimal medium	HMM
in-vitro (YM rich medium)	Minato 2019 mSys	non-essential	YM rich medium	HMM	7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium	Minato 2019 mSys	NO (LFC=-2.19)	YM rich vs minimal medium	resampling

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- Rv1116 (-) (Direct binding)
- Rv2031c (hspX) (Direct binding)
- Rv2032 (acg) (Direct binding)
- Rv2028c (-) (Upstream of operon)
- Rv2029c (pfkB) (Upstream of operon)
- Rv2030c (-) (Upstream of operon)
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Rvnt13 (-)
Downregulated by:

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv2745c (clgR)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv2939	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2939	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2935	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2935	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2934	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2934	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2933	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2933	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2932	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2932	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2931	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2931	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2930	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2930	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2745c	balaganesh727	IEP		Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv2745c	balaganesh727	IEP		Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv2744c	balaganesh727	IEP		Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Citation	Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. S. Mehra & D. Kaushal J. Bacteriol. 2009	balaganesh727	IEP	19376862	Co-expression (Functional linkage)
Interaction	Regulatory Rv1221	balaganesh727	IEP		Co-expression (Functional linkage) S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Citation	Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. PA. Fontn, V. Aris et al. J. Infect. Dis. 2008	balaganesh727	IEP	18657035	Co-expression (Functional linkage)
Interaction	Regulatory Rv1221	balaganesh727	IEP		Co-expression (Functional linkage) PA. Fontn, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008
Citation	The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. R. Manganelli, MI. Voskuil et al. Mol. Microbiol. 2001	balaganesh727	IEP	11489128	Co-expression (Functional linkage)
Interaction	Regulatory Rv1221	balaganesh727	IEP		Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Citation	Global transcriptional response to vancomycin in Mycobacterium tuberculosis. R. Provvedi, F. Boldrin et al. Microbiology (Reading, Engl.) 2009	balaganesh727	IEP	19332811	Co-expression (Functional linkage)
Interaction	Regulatory Rv2743c	balaganesh727	IEP		Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv2744c	balaganesh727	IEP		Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2743c	balaganesh727	IEP		Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2743c	balaganesh727	IEP		Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3418c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2937	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2938	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2939	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3417c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2933	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2934	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2935	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2936	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2930	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2931	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2932	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1221	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Regulatory Rv2939

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2939

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2935

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2935

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2934

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2934

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2933

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2933

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2932

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2932

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2931

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2931

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2930

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2930

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2745c

balaganesh727

IEP

Co-expression (Functional linkage)
R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009

Interaction

Regulatory Rv2745c

balaganesh727

IEP

Co-expression (Functional linkage)
R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009

Interaction

Regulatory Rv2744c

balaganesh727

IEP

Co-expression (Functional linkage)
R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009

Citation

Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. S. Mehra & D. Kaushal J. Bacteriol. 2009

balaganesh727

IEP

19376862

Co-expression (Functional linkage)

Interaction

Regulatory Rv1221

balaganesh727

IEP

Co-expression (Functional linkage)
S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009

Citation

Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. PA. Fontn, V. Aris et al. J. Infect. Dis. 2008

balaganesh727

IEP

18657035

Co-expression (Functional linkage)

Interaction

Regulatory Rv1221

balaganesh727

IEP

Co-expression (Functional linkage)
PA. Fontn, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008

Citation

The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. R. Manganelli, MI. Voskuil et al. Mol. Microbiol. 2001

balaganesh727

IEP

11489128

Co-expression (Functional linkage)

Interaction

Regulatory Rv1221

balaganesh727

IEP

Co-expression (Functional linkage)
R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001

Citation

Global transcriptional response to vancomycin in Mycobacterium tuberculosis. R. Provvedi, F. Boldrin et al. Microbiology (Reading, Engl.) 2009

balaganesh727

IEP

19332811

Co-expression (Functional linkage)

Interaction

Regulatory Rv2743c

balaganesh727

IEP

Co-expression (Functional linkage)
R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009

Interaction

Regulatory Rv2744c

balaganesh727

IEP

Interaction

Regulatory Rv2743c

balaganesh727

IEP

Interaction

Regulatory Rv2743c

balaganesh727

IEP

Co-expression (Functional linkage)
R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3418c

yamir.moreno

IDA

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2937

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2938

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2939

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3417c

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2933

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2934

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2935

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2936

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2930

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2931

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2932

yamir.moreno

IDA

Interaction

RegulatedBy Rv1221

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Comments

TB Genome Annotation Portal

Rv2745c (clgR)

Amino Acid Sequence

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Interactions based on TFOE data (Rustad et al. 2014)

TBCAP

Comments

Analysis of Positive Selection in Clinical Isolates new