TB Genome Annotation Portal

Rv2737c (recA)

Amino Acid Sequence

MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHAL
DPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKI
GVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWF
DQGTRDVIGLRIAGGAIVWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPADHARLLGYLIGDGRDGWVGGKTPINFINVQRALIDDVTR
IAATLGCAAHPQGRISLAIAHRPGERNGVADLCQQAGIYGKLAWEKTIPNWFFEPDIAADIVGNLLFGLFESDGWVSREQTGALRVGYTTTSEQLAHQIH
WLLLRFGVGSTVRDYDPTQKRPSIVNGRRIQSKRQVFEVRISGMDNVTAFAESVPMWGPRGAALIQAIPEATQGRRRGSQATYLAAEMTDAVLNYLDERG
VTAQEAAAMIGVASGDPRGGMKQVLGASRLRRDRVQALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFDLEVEELHTLVAEGVVVHNCSPPFKQAE
FDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGAVVTDDPSNDGVLPAPVDF
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2737c/recA, gene len: 2372 bp, num TA sites: 29
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microgrowth-defect 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.39)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifegrowth defect7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifegrowth defectBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.4)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.17)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.55 (0.68)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2737c/recARv1219c/-1.09
    Rv2737c/recARv0022c/whiB5-1.15
    Rv2737c/recARv3223c/sigH-1.19


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2737c (recA)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
    InteractionPhysicalInteraction Rv2882cpriti.prietyRCAGene Neighbourhood
    K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
    InteractionPhysicalInteraction Rv2840cakvsangliRCA
    authors,L. Cabusora,E. Sutton,A. Fulmer,CV. Forst Differential network expression during drug and stress response. Bioinformatics 2005
    CitationrecX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. V. Pags, N. Koffel-Schwartz et al. DNA Repair (Amst.) 2003balaganesh727IEP12547390Co-expression (Functional linkage)
    InteractionRegulatory Rv2720balaganesh727IEPCo-expression (Functional linkage)
    V. Pags, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
    InteractionRegulatory Rv2736cbalaganesh727IEPCo-expression (Functional linkage)
    V. Pags, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
    CitationMycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. K. Raman & N. Chandra BMC Microbiol. 2008balaganesh727IEP19105810Co-expression (Functional linkage)
    InteractionRegulatory Rv2720balaganesh727IEPCo-expression (Functional linkage)
    K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
    InteractionRegulatory Rv2736cbalaganesh727IEPCo-expression (Functional linkage)
    K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
    CitationThe majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. L. Rand, J. Hinds et al. Mol. Microbiol. 2003balaganesh727IEP14617159Co-expression (Functional linkage)
    InteractionRegulatory Rv2720balaganesh727IEPCo-expression (Functional linkage)
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    InteractionRegulatory Rv2736cbalaganesh727IEPCo-expression (Functional linkage)
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    CitationMycobacterial recA is cotranscribed with a potential regulatory gene called recX. KG. Papavinasasundaram, F. Movahedzadeh et al. Mol. Microbiol. 1997balaganesh727IEP9140972Co-expression (Functional linkage)
    InteractionRegulatory Rv2720balaganesh727IEPCo-expression (Functional linkage)
    KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
    InteractionRegulatory Rv2736cbalaganesh727IEPCo-expression (Functional linkage)
    KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
    InteractionRegulatory Rv2736cbalaganesh727IEPCo-expression (Functional linkage)
    KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
    InteractionRegulatory Rv2736cbalaganesh727IEPCo-expression (Functional linkage)
    V. Pags, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
    InteractionRegulatory Rv2720ahal4789IEPCo-expression (Functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    InteractionRegulatory Rv2720ahal4789IEPCo-expression (Functional linkage)
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    InteractionRegulatory Rv2720ahal4789IEPCo-expression (Functional linkage)
    authors,C. Bridges-Webb Narcotic analgesics, addiction and endorphins. Med. J. Aust. 1979
    InteractionTranscription Rv2016sourish10NASCo-occurrence (Functional linkage)
    V. Gamulin, H. Cetkovic et al. Identification of a promoter motif regulating the major DNA damage response mechanism of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2004
    InteractionRegulatory Rv0823csourish10NASCo-occurrence (Functional linkage)
    K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
    InteractionTranscription Rv0823csourish10NASCo-occurrence (Functional linkage)
    K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
    InteractionPhysicalInteraction Rv0003singhpankaj2116TAS
    P. Singh, KN. Patil et al. Mycobacterium tuberculosis UvrD1 and UvrA Proteins Suppress DNA Strand Exchange Promoted by Cognate and Non-cognate RecA Proteins. Biochemistry 2010
    InteractionPhysicalInteraction Rv0003singhpankaj2116TAS
    authors,V. Mizrahi,SJ. Andersen DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Mol. Microbiol. 1998
    InteractionRegulatedBy Rv2720yamir.morenoIMPHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
    InteractionRegulatedBy Rv2720yamir.morenoIDAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
    InteractionRegulatedBy Rv2720yamir.morenoISAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
    InteractionRegulatedBy Rv2720yamir.morenoIDAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
    InteractionRegulatedBy Rv2720yamir.morenoIDAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatedBy Rv2720yamir.morenoIDAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatedBy Rv2720yamir.morenoIMPHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatedBy Rv2720yamir.morenoISAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatedBy Rv2720yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv2720yamir.morenoISOLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv2720yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    OtherTBPWY:Recombination repairvmizrahiNone

    Comments