TB Genome Annotation Portal

Rv2737c (recA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: protein recA
  • REFSEQ: DNA recombination protein RecA
  • PATRIC: RecA protein @ intein-containing
  • TUBERCULIST: RecA protein (recombinase A) [contains: endonuclease PI-MTUI (MTU RecA intein)].
  • NCBI: RecA protein (recombinase A) [contains: endonuclease PI-MTUI (MTU RecA intein)]
  • updated information (H37Rv4):
    • gene name: recA
    • function:
    • reference:
• Type: Not Target
• Start: 3049052
• End: 3051424
• Operon:


• Trans-membrane region:
  
• Role: II.A.5 - DNA replication, repair, recombination and restriction/modification
• GO terms:
  • GO:0090305 - nucleic acid phosphodiester bond hydrolysis (Uniprot)
  • GO:0046677 - response to antibiotic (Uniprot)
  • GO:0042148 - strand invasion (Uniprot)
  • GO:0030145 - manganese ion binding (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016539 - intein-mediated protein splicing (Uniprot)
  • GO:0009650 - UV protection (Uniprot)
  • GO:0009432 - SOS response (Uniprot)
  • GO:0008094 - DNA-dependent ATPase activity (Uniprot)
  • GO:0006974 - cellular response to DNA damage stimulus (Uniprot)
  • GO:0006314 - intron homing (Uniprot)
  • GO:0006310 - DNA recombination (Uniprot)
  • GO:0006281 - DNA repair (Uniprot)
  • GO:0006259 - DNA metabolic process (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004520 - endodeoxyribonuclease activity (Uniprot)
  • GO:0004519 - endonuclease activity (Uniprot)
  • GO:0004518 - nuclease activity (Uniprot)
  • GO:0003697 - single-stranded DNA binding (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
  • GO:0000725 - recombinational repair (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0000150 - recombinase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3igd, 1g18, 1g19, 2imz, 1mo4, 1mo5, 1mo6, 3ifj, 2l8l, 1mo3, 2in8, 2in9, 2in0
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4OQF	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis RecA glycerol bound low temperature structure IIB-SR
  3IFJ	100%	Mycobacterium tuberculosis	Crystal structure of Mtu recA intein, splicing domain
  2IN9	100%	Mycobacterium tuberculosis	crystal structure of Mtu recA intein, splicing domain
  5K08	98%	Mycobacterium tuberculosis	RecA mini intein-Zeise's salt complex
  5I0A	98%	Mycobacterium tuberculosis	RecA mini intein in complex with cisplatin
  3IGD	98%	Mycobacterium tuberculosis	Crystal structure of Mtu recA intein, splicing domain
  2L8L	98%	Mycobacterium tuberculosis	Structure of an engineered splicing intein mutant based on Mycobacterium tuberculosis RecA
  2IN0	98%	Mycobacterium tuberculosis	crystal structure of Mtu recA intein splicing domain
  2IN8	97%	Mycobacterium tuberculosis	crystal structure of Mtu recA intein, splicing domain
  2ZRP	93%	Mycobacterium smegmatis str. MC2 155	MsRecA dATP form II'

• Links to additional information on recA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.025 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology
  • Mycobrowser
  • PATRIC

Amino Acid Sequence

MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHAL
DPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKI
GVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWF
DQGTRDVIGLRIAGGAIVWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIPADHARLLGYLIGDGRDGWVGGKTPINFINVQRALIDDVTR
IAATLGCAAHPQGRISLAIAHRPGERNGVADLCQQAGIYGKLAWEKTIPNWFFEPDIAADIVGNLLFGLFESDGWVSREQTGALRVGYTTTSEQLAHQIH
WLLLRFGVGSTVRDYDPTQKRPSIVNGRRIQSKRQVFEVRISGMDNVTAFAESVPMWGPRGAALIQAIPEATQGRRRGSQATYLAAEMTDAVLNYLDERG
VTAQEAAAMIGVASGDPRGGMKQVLGASRLRRDRVQALADALDDKFLHDMLAEELRYSVIREVLPTRRARTFDLEVEELHTLVAEGVVVHNCSPPFKQAE
FDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGAVVTDDPSNDGVLPAPVDF

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.51 (0.2)	1.49 (0.8)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link