TB Genome Annotation Portal

Rv2725c (hflX)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: GTP-binding protein HflX
  • REFSEQ: GTP-binding protein HflX
  • PATRIC: GTP-binding protein HflX
  • TUBERCULIST: Probable GTP-binding protein HflX
  • NCBI: Probable GTP-binding protein HflX
  • updated information (H37Rv4):
    • gene name: hflX
    • function: ribosome splitting factor
    • reference: Rudra (2020) PMID: 31871194; Kumar 2021, Gene Reports
• Type: Not Target
• Start: 3037427
• End: 3038914
• Operon:


• Trans-membrane region:
  
• Role: II.B.3 - Proteins, peptides and glycopeptides
• GO terms:
  • GO:0043022 - ribosome binding (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005525 - GTP binding (Uniprot)
  • GO:0003924 - GTPase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1JAL	43%	Haemophilus influenzae	YCHF PROTEIN (HI0393)
  5ZZM	40%	Escherichia coli (strain K12)	E. coli 50S subunit bound HflX protein in presence of ATP (AMP-PNP) and GTP (GMP-PNP) analogs.
  5ADY	40%	ESCHERICHIA COLI K-12	Cryo-EM structures of the 50S ribosome subunit bound with HflX

• Links to additional information on hflX:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.629 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MPANSDARPAATCHHRVLAMTYPDPPQTGLSDFTPSLGELALEDRSALRRVAGLSTELADVSEVEYRQLRLERVVLVGVWTEGSAADNRASLAELAALAE
TAGSQVLEGLIQRRDKPDPSTYIGSGKAAELREVIVATGADTVICDGELSPAQLTALEKAVQVKVIDRTALILDIFAQHATSREGKAQVSLAQMEYMLPR
LRGWGESMSRQAGGRAGGSGGGVGLRGPGETKIETDRRRIRERMAKLRRDIRAMKQVRDTQRSRRRHSDVPSIAIVGYTNAGKSSLLNALTGAGVLVQDA
LFATLEPTTRRAEFGDGRPVVLTDTVGFVRHLPTQLVEAFRSTLEEVVHADLLVHVVDGSDGHPLAQIDAVRQVISEVIADHDGDPPPELLVVNKVDVAS
DLMLAKLRHGLPGAVFVSARTGDGIDALRRRMAELVVPADTAVDVVIPYDRGDLVARVHADGRIQQAEHKPEGTRIKARVPEALAATLREFAPRA

Additional Information

Rudra et al (2020). Mycobacterial HflX is a ribosome splitting factor that mediates antibiotic resistance. PNAS. https://www.pnas.org/content/117/1/629