TB Genome Annotation Portal

Rv2724c (fadE20)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: acyl-CoA dehydrogenase fadE20
  • REFSEQ: acyl-CoA dehydrogenase FADE20
  • PATRIC: Acyl-CoA dehydrogenase FadE20
  • TUBERCULIST: Probable acyl-CoA dehydrogenase FadE20
  • NCBI: Probable acyl-CoA dehydrogenase FadE20
  • updated information (H37Rv4):
    • gene name: fadE20
    • function:
    • reference:
• Type: Not Target
• Start: 3036131
• End: 3037291
• Operon:


• Trans-membrane region:
  
• Role: I.A.3 - Fatty acids
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0050660 - flavin adenine dinucleotide binding (Uniprot)
  • GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0003995 - acyl-CoA dehydrogenase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2PG0	53%	Geobacillus kaustophilus	Crystal structure of acyl-CoA dehydrogenase from Geobacillus kaustophilus
  3P4T	39%	Mycobacterium smegmatis	Crystal structure of a putative acyl-CoA dehydrogenase from Mycobacterium smegmatis
  3OIB	39%	Mycobacterium smegmatis	Crystal structure of a putative ACYL-COA Dehydrogenase from mycobacterium smegmatis, Iodide soak
  3R7K	39%	Mycobacterium abscessus	Crystal structure of a probable acyl CoA dehydrogenase from Mycobacterium abscessus ATCC 19977 / DSM 44196
  5LNX	38%	Bacillus subtilis (strain 168)	Crystal structure of MmgC, an acyl-CoA dehydrogenase from bacillus subtilis.
  4U83	38%	Brucella abortus	Structure of Brucella Abortus Butyryl-CoA dehydrogenase
  1UKW	38%	Thermus thermophilus	Crystal structure of medium-chain acyl-CoA dehydrogenase from Thermus thermophilus HB8
  4L1F	37%	Acidaminococcus fermentans	Electron transferring flavoprotein of Acidaminococcus fermentans: Towards a mechanism of flavin-based electron bifurcation
  2D29	36%	Thermus thermophilus	Structural study on project ID TT0172 from Thermus thermophilus HB8
  2CX9	36%	Thermus thermophilus	Crystal structure of acyl-CoA dehydrogenase

• Links to additional information on fadE20:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.856 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MGSATKYQRTLFEPEHELFRESYRAFLDRHVAPYHDEWEKTKIVDRGVWLEAGKQGFLGMAVPEEYGGGGNADFRYNTVITEETCAGRYSGIGFGLHNDI
VAPYLLALATEEQKRRWFPNFCTGELITAIAMTEPGTGSDLQGITTRAVKHGDHYVLNGSKTFITNGINSDLVIVVAQTDPEKGAQGFSLLVVERGMAGF
ERGRQLDKIGLDAQDTAELSFTDVAVPAENLLGQEGMGFIYLMQNLPQERISIAIMAAAGMESVLEQTLQYAKERKAFGRSIGSFQNSRFLLAELATEAT
VVRIMVDEFIKLHLAGKLTAEQAAMAKWYATEKQVYLNDRCLQLHGGYGYMREYPVARAYLDSRVQTIYGGTTEIMKEIIGRGLGV

Additional Information