TB Genome Annotation Portal

Rv2720 (lexA)

Amino Acid Sequence

MNDSNDTSVAGGAAGADSRVLSADSALTERQRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVNVRGADDAALP
PVTEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFK
RAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.06 (0.44)1.72 (0.55)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2720/lexA, gene len: 710 bp, num TA sites: 8
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth defect7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.0)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.0)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    RNA processing and modification
    Energy production and conversion
    Chromatin structure and dynamics
    Amino acid transport and metabolism
    Cell cycle control, cell division, chromosome partitioning
    Carbohydrate transport and metabolism
    Nucleotide transport and metabolism
    Lipid transport and metabolism
    Coenzyme transport and metabolism
    Transcription
    Translation, ribosomal structure and biogenesis
    Cell wall/membrane/envelope biogenesis
    Replication, recombination and repair
    Posttranslational modification, protein turnover, chaperones
    Cell motility
    Secondary metabolites biosynthesis, transport and catabolism
    Inorganic ion transport and metabolism
    Function unknown
    General function prediction only
    Intracellular trafficking, secretion, and vesicular transport
    Signal transduction mechanisms
    Extracellular structures
    Defense mechanisms
    Nuclear structure
    Cytoskeleton
  • BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)
  • Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
    Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
  • BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)
  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2720 (lexA)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv3777priti.prietyTAS
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    InteractionRegulatory Rv3777priti.prietyTAS
    A. Argyrou, L. Jin et al. Proteome-wide profiling of isoniazid targets in Mycobacterium tuberculosis. Biochemistry 2006
    InteractionRegulatory Rv3777ashwinigbhatTAS
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    InteractionRegulatory Rv3777ashwinigbhatTAS
    A. Argyrou, L. Jin et al. Proteome-wide profiling of isoniazid targets in Mycobacterium tuberculosis. Biochemistry 2006
    InteractionRegulatory Rv3776priti.prietyIEPCoexpression
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv3776ashwinigbhatIEPCoexpression
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv3074shahanup86NAS
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv2737cbalaganesh727IEPCo-expression (Functional linkage)
    V. Pags, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
    InteractionRegulatory Rv2737cbalaganesh727IEPCo-expression (Functional linkage)
    K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
    InteractionRegulatory Rv2737cbalaganesh727IEPCo-expression (Functional linkage)
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    InteractionRegulatory Rv2737cbalaganesh727IEPCo-expression (Functional linkage)
    KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
    CitationDefinition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002ahal4789IEP12029045Co-expression (Functional linkage)
    InteractionRegulatory Rv2719cahal4789IEPCo-expression (Functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    CitationThe role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. EM. Dullaghan, PC. Brooks et al. Microbiology (Reading, Engl.) 2002ahal4789IEP12427951Co-expression (Functional linkage)
    InteractionRegulatory Rv2719cahal4789IEPCo-expression (Functional linkage)
    EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
    CitationInterference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006ahal4789IEP16942606Co-expression (Functional linkage)
    InteractionRegulatory Rv2737cahal4789IEPCo-expression (Functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    CitationThe majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. L. Rand, J. Hinds et al. Mol. Microbiol. 2003ahal4789IEP14617159Co-expression (Functional linkage)
    InteractionRegulatory Rv2737cahal4789IEPCo-expression (Functional linkage)
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    CitationNarcotic analgesics, addiction and endorphins. authors,C. Bridges-Webb Med. J. Aust. 1979ahal4789IEP34779Co-expression (Functional linkage)
    InteractionRegulatory Rv2737cahal4789IEPCo-expression (Functional linkage)
    authors,C. Bridges-Webb Narcotic analgesics, addiction and endorphins. Med. J. Aust. 1979
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
    CitationInterference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006ahal4789IEP16942606Co-expression (Functional linkage)
    InteractionRegulatory Rv2719cahal4789IEPCo-expression (Functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    CitationThe mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. PC. Brooks, LF. Dawson et al. J. Bacteriol. 2006ahal4789IEP16885473Co-expression (Functional linkage)
    InteractionRegulatory Rv2719cahal4789IEPCo-expression (Functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    InteractionRegulatory Rv2578cxaccheusIEPCo-expression (Functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv2100ahal4789IEPCo-expression (Functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv2100sourish10IEPCo-expression (Functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv1702csalluamity1IEPCo-expression (Functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv1378charsharohiratruefriendIEPMicorarray Analysis
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv1000charsharohiratruefriendTASStructural Analysis
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv1000charsharohiratruefriendTASStructural Analysis
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    InteractionRegulatory Rv1000charsharohiratruefriendTASStructural Analysis
    authors,L. Aravind,EV. Koonin The DNA-repair protein AlkB, EGL-9, and leprecan define new families of 2-oxoglutarate- and iron-dependent dioxygenases. Genome Biol. 2001
    InteractionRegulatory Rv1000charsharohiratruefriendTASSpectrophotometric Assay
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv1000charsharohiratruefriendTASSpectrophotometric Assay
    L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
    InteractionRegulatory Rv1000charsharohiratruefriendTASSpectrophotometric Assay
    authors,L. Aravind,EV. Koonin The DNA-repair protein AlkB, EGL-9, and leprecan define new families of 2-oxoglutarate- and iron-dependent dioxygenases. Genome Biol. 2001
    InteractionRegulatory Rv0515gaat3sIEPCo-expression (Functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv0336vizhi.gurusamyRCA
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv0182cpriti.prietyIEPCo-expression (Functional linkage)
    JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
    CitationMtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005yamir.morenoIMP15722376Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    InteractionRegulates Rv2737cyamir.morenoIMPHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
    CitationMtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005yamir.morenoIDA15722376Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    InteractionRegulates Rv2737cyamir.morenoIDAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
    CitationMtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005yamir.morenoISA15722376Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    InteractionRegulates Rv2737cyamir.morenoISAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
    CitationMtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005yamir.morenoIDA15722376Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    InteractionRegulates Rv2737cyamir.morenoIDAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
    InteractionRegulates Rv2737cyamir.morenoIDAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    CitationDefinition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002yamir.morenoIMP12029045Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    InteractionRegulates Rv2737cyamir.morenoIMPHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    CitationDefinition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002yamir.morenoIDA12029045Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    InteractionRegulates Rv2737cyamir.morenoIDAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    CitationDefinition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002yamir.morenoISA12029045Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    InteractionRegulates Rv2737cyamir.morenoISAHomology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    CitationDefinition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002yamir.morenoIDA12029045Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3776yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2737cyamir.morenoISOLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3074yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3370cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3395cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv2719cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2720yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv2720yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2720yamir.morenoISOLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv2720yamir.morenoISOLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2737cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2343cyamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv2579yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv2594cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2703yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulates Rv1633yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1638yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1696yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1702cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv2100yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv0949yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1000cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1379yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1420yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0058yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0071yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0336yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0515yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv0054yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2720yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    InteractionRegulatedBy Rv2720yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2737cyamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1633yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1638yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1696yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2343cyamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2703yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv0054yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv0949yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1420yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    OtherTBPWY:General/ regulationvmizrahiCrystallization and preliminary X-ray studies of the C-terminal domain
    OtherTBPWY:General/ regulationvmizrahiThe role of multiple SOS boxes upstream of lexA investigated

    Comments