Rv2720 (lexA)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: LexA repressor
- REFSEQ: LexA repressor
- PATRIC: SOS-response repressor and protease LexA (EC 3.4.21.88)
- TUBERCULIST: Repressor LexA
- NCBI: Repressor LexA
- updated information (H37Rv4):
  - gene name: lexA
  - function:
  - reference:
Type: Not Target
Start: 3031788
End: 3032498
Operon:

Trans-membrane region:
Role: I.J.1 - Repressors/activators
GO terms:
- GO:0046677 - response to antibiotic (Uniprot)
- GO:0045892 - negative regulation of transcription, DNA-templated (Uniprot)
- GO:0016787 - hydrolase activity (Uniprot)
- GO:0009432 - SOS response (Uniprot)
- GO:0006974 - cellular response to DNA damage stimulus (Uniprot)
- GO:0006508 - proteolysis (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0006281 - DNA repair (Uniprot)
- GO:0006260 - DNA replication (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0004252 - serine-type endopeptidase activity (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6A2R	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Mycobacterium tuberculosis LexA C-domain II
6A2Q	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis LexA C-domain I
6A2T	99%	Mycobacterium tuberculosis	Mycobacterium tuberculosis LexA C-domain K197A
6A2S	99%	Mycobacterium tuberculosis	Mycobacterium tuberculosis LexA C-domain S160A
3K2Z	39%	Thermotoga maritima	Crystal structure of a LexA protein from Thermotoga maritima
1JHC	38%	Escherichia coli	LEXA S119A C-TERMINAL TRYPTIC FRAGMENT
1AY9	38%	Escherichia coli	WILD-TYPE UMUD' FROM E. COLI
1JHE	36%	Escherichia coli	LEXA L89P Q92W E152A K156A MUTANT
3BDN	36%	Enterobacteria phage lambda	Crystal Structure of the Lambda Repressor
2HO0	36%	Escherichia coli	Structure of a Hyper-cleavable Monomeric Fragment of Phage Lambda Repressor Containing the Cleavage Site Region

Links to additional information on lexA:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -1.608 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- BioCyc
- Systems Biology
- Mycobrowser
- PATRIC

Amino Acid Sequence

MNDSNDTSVAGGAAGADSRVLSADSALTERQRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVNVRGADDAALP
PVTEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFK
RAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.998450; 8 non-insertions in a row out of 8 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999700; 8 non-insertions in a row out of 8 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999900; 8 non-insertions in a row out of 8 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999550; 8 non-insertions in a row out of 8 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999450; 8 non-insertions in a row out of 8 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.4
Growth-Defect	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0081 (-) (Direct binding)
- Rv1049 (-) (Direct binding)
- Rv2034 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Rv2720 (lexA)
Upregulated by:
- Rv2720 (lexA)
Downregulates:
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv2720 (lexA)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv3777	priti.priety	TAS		L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv3777	priti.priety	TAS		A. Argyrou, L. Jin et al. Proteome-wide profiling of isoniazid targets in Mycobacterium tuberculosis. Biochemistry 2006
Interaction	Regulatory Rv3777	ashwinigbhat	TAS		L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv3777	ashwinigbhat	TAS		A. Argyrou, L. Jin et al. Proteome-wide profiling of isoniazid targets in Mycobacterium tuberculosis. Biochemistry 2006
Interaction	Regulatory Rv3776	priti.priety	IEP		Coexpression EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv3776	ashwinigbhat	IEP		Coexpression EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv3074	shahanup86	NAS		EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) V. Pags, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
Citation	Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002	ahal4789	IEP	12029045	Co-expression (Functional linkage)
Interaction	Regulatory Rv2719c	ahal4789	IEP		Co-expression (Functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Citation	The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. EM. Dullaghan, PC. Brooks et al. Microbiology (Reading, Engl.) 2002	ahal4789	IEP	12427951	Co-expression (Functional linkage)
Interaction	Regulatory Rv2719c	ahal4789	IEP		Co-expression (Functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Citation	Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006	ahal4789	IEP	16942606	Co-expression (Functional linkage)
Interaction	Regulatory Rv2737c	ahal4789	IEP		Co-expression (Functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Citation	The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. L. Rand, J. Hinds et al. Mol. Microbiol. 2003	ahal4789	IEP	14617159	Co-expression (Functional linkage)
Interaction	Regulatory Rv2737c	ahal4789	IEP		Co-expression (Functional linkage) L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Citation	Narcotic analgesics, addiction and endorphins. authors,C. Bridges-Webb Med. J. Aust. 1979	ahal4789	IEP	34779	Co-expression (Functional linkage)
Interaction	Regulatory Rv2737c	ahal4789	IEP		Co-expression (Functional linkage) authors,C. Bridges-Webb Narcotic analgesics, addiction and endorphins. Med. J. Aust. 1979
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Citation	Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006	ahal4789	IEP	16942606	Co-expression (Functional linkage)
Interaction	Regulatory Rv2719c	ahal4789	IEP		Co-expression (Functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Citation	The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. PC. Brooks, LF. Dawson et al. J. Bacteriol. 2006	ahal4789	IEP	16885473	Co-expression (Functional linkage)
Interaction	Regulatory Rv2719c	ahal4789	IEP		Co-expression (Functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Regulatory Rv2578c	xaccheus	IEP		Co-expression (Functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv2100	ahal4789	IEP		Co-expression (Functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv2100	sourish10	IEP		Co-expression (Functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv1702c	salluamity1	IEP		Co-expression (Functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv1378c	harsharohiratruefriend	IEP		Micorarray Analysis EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv1000c	harsharohiratruefriend	TAS		Structural Analysis EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv1000c	harsharohiratruefriend	TAS		Structural Analysis L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv1000c	harsharohiratruefriend	TAS		Structural Analysis authors,L. Aravind,EV. Koonin The DNA-repair protein AlkB, EGL-9, and leprecan define new families of 2-oxoglutarate- and iron-dependent dioxygenases. Genome Biol. 2001
Interaction	Regulatory Rv1000c	harsharohiratruefriend	TAS		Spectrophotometric Assay EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv1000c	harsharohiratruefriend	TAS		Spectrophotometric Assay L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv1000c	harsharohiratruefriend	TAS		Spectrophotometric Assay authors,L. Aravind,EV. Koonin The DNA-repair protein AlkB, EGL-9, and leprecan define new families of 2-oxoglutarate- and iron-dependent dioxygenases. Genome Biol. 2001
Interaction	Regulatory Rv0515	gaat3s	IEP		Co-expression (Functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv0336	vizhi.gurusamy	RCA		EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv0182c	priti.priety	IEP		Co-expression (Functional linkage) JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Citation	MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005	yamir.moreno	IMP	15722376	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
Interaction	Regulates Rv2737c	yamir.moreno	IMP		Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
Citation	MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005	yamir.moreno	IDA	15722376	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
Interaction	Regulates Rv2737c	yamir.moreno	IDA		Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
Citation	MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005	yamir.moreno	ISA	15722376	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
Interaction	Regulates Rv2737c	yamir.moreno	ISA		Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
Citation	MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005	yamir.moreno	IDA	15722376	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
Interaction	Regulates Rv2737c	yamir.moreno	IDA		Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
Interaction	Regulates Rv2737c	yamir.moreno	IDA		Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Citation	Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002	yamir.moreno	IMP	12029045	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
Interaction	Regulates Rv2737c	yamir.moreno	IMP		Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Citation	Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002	yamir.moreno	IDA	12029045	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
Interaction	Regulates Rv2737c	yamir.moreno	IDA		Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Citation	Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002	yamir.moreno	ISA	12029045	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
Interaction	Regulates Rv2737c	yamir.moreno	ISA		Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Citation	Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002	yamir.moreno	IDA	12029045	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3776	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2737c	yamir.moreno	ISO		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3074	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3370c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3395c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2719c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2720	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2720	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2720	yamir.moreno	ISO		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2720	yamir.moreno	ISO		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2737c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2343c	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2579	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2594c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2703	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1633	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv1638	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv1696	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1702c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2100	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv0949	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1000c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1379	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv1420	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv0058	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv0071	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv0336	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv0515	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	ISO	18985025	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv0054	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2720	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv2720	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2737c	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv1633	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv1638	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv1696	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2343c	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv2703	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv0054	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv0949	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006	yamir.moreno	ISO	16530225	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction	Regulates Rv1420	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Other	TBPWY:General/ regulation	vmizrahi			Crystallization and preliminary X-ray studies of the C-terminal domain
Other	TBPWY:General/ regulation	vmizrahi			The role of multiple SOS boxes upstream of lexA investigated

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Regulatory Rv3777

priti.priety

TAS

L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003

Interaction

Regulatory Rv3777

priti.priety

TAS

A. Argyrou, L. Jin et al. Proteome-wide profiling of isoniazid targets in Mycobacterium tuberculosis. Biochemistry 2006

Interaction

Regulatory Rv3777

ashwinigbhat

TAS

L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003

Interaction

Regulatory Rv3777

ashwinigbhat

TAS

A. Argyrou, L. Jin et al. Proteome-wide profiling of isoniazid targets in Mycobacterium tuberculosis. Biochemistry 2006

Interaction

Regulatory Rv3776

priti.priety

IEP

Coexpression
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv3776

ashwinigbhat

IEP

Coexpression
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv3074

shahanup86

NAS

EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv2737c

balaganesh727

IEP

Co-expression (Functional linkage)
V. Pags, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003

Interaction

Regulatory Rv2737c

balaganesh727

IEP

Co-expression (Functional linkage)
K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008

Interaction

Regulatory Rv2737c

balaganesh727

IEP

Co-expression (Functional linkage)
L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003

Interaction

Regulatory Rv2737c

balaganesh727

IEP

Co-expression (Functional linkage)
KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997

Citation

Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002

ahal4789

IEP

12029045

Co-expression (Functional linkage)

Interaction

Regulatory Rv2719c

ahal4789

IEP

Co-expression (Functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Citation

The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. EM. Dullaghan, PC. Brooks et al. Microbiology (Reading, Engl.) 2002

ahal4789

IEP

12427951

Co-expression (Functional linkage)

Interaction

Regulatory Rv2719c

ahal4789

IEP

Co-expression (Functional linkage)
EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002

Citation

Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006

ahal4789

IEP

16942606

Co-expression (Functional linkage)

Interaction

Regulatory Rv2737c

ahal4789

IEP

Co-expression (Functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Citation

The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. L. Rand, J. Hinds et al. Mol. Microbiol. 2003

ahal4789

IEP

14617159

Co-expression (Functional linkage)

Interaction

Regulatory Rv2737c

ahal4789

IEP

Co-expression (Functional linkage)
L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003

Citation

Narcotic analgesics, addiction and endorphins. authors,C. Bridges-Webb Med. J. Aust. 1979

ahal4789

IEP

34779

Co-expression (Functional linkage)

Interaction

Regulatory Rv2737c

ahal4789

IEP

Co-expression (Functional linkage)
authors,C. Bridges-Webb Narcotic analgesics, addiction and endorphins. Med. J. Aust. 1979

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002

Citation

Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006

ahal4789

IEP

16942606

Co-expression (Functional linkage)

Interaction

Regulatory Rv2719c

ahal4789

IEP

Co-expression (Functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Citation

The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. PC. Brooks, LF. Dawson et al. J. Bacteriol. 2006

ahal4789

IEP

16885473

Co-expression (Functional linkage)

Interaction

Regulatory Rv2719c

ahal4789

IEP

Co-expression (Functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Interaction

Regulatory Rv2578c

xaccheus

IEP

Co-expression (Functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv2100

ahal4789

IEP

Co-expression (Functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv2100

sourish10

IEP

Co-expression (Functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv1702c

salluamity1

IEP

Co-expression (Functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv1378c

harsharohiratruefriend

IEP

Micorarray Analysis
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv1000c

harsharohiratruefriend

TAS

Structural Analysis
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv1000c

harsharohiratruefriend

TAS

Structural Analysis
L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003

Interaction

Regulatory Rv1000c

harsharohiratruefriend

TAS

Structural Analysis
authors,L. Aravind,EV. Koonin The DNA-repair protein AlkB, EGL-9, and leprecan define new families of 2-oxoglutarate- and iron-dependent dioxygenases. Genome Biol. 2001

Interaction

Regulatory Rv1000c

harsharohiratruefriend

TAS

Spectrophotometric Assay
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv1000c

harsharohiratruefriend

TAS

Spectrophotometric Assay
L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003

Interaction

Regulatory Rv1000c

harsharohiratruefriend

TAS

Spectrophotometric Assay
authors,L. Aravind,EV. Koonin The DNA-repair protein AlkB, EGL-9, and leprecan define new families of 2-oxoglutarate- and iron-dependent dioxygenases. Genome Biol. 2001

Interaction

Regulatory Rv0515

gaat3s

IEP

Co-expression (Functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv0336

vizhi.gurusamy

RCA

EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv0182c

priti.priety

IEP

Co-expression (Functional linkage)
JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008

Citation

MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski Bioinformatics 2005

yamir.moreno

IMP

15722376

Interaction

Regulates Rv2737c

yamir.moreno

IMP

Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005

Citation

yamir.moreno

IDA

15722376

Interaction

Regulates Rv2737c

yamir.moreno

IDA

Citation

yamir.moreno

ISA

15722376

Interaction

Regulates Rv2737c

yamir.moreno

ISA

Citation

yamir.moreno

IDA

15722376

Interaction

Regulates Rv2737c

yamir.moreno

IDA

Interaction

Regulates Rv2737c

yamir.moreno

IDA

Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Citation

Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002

yamir.moreno

IMP

12029045

Interaction

Regulates Rv2737c

yamir.moreno

IMP

Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Citation

Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002

yamir.moreno

IDA

12029045

Interaction

Regulates Rv2737c

yamir.moreno

IDA

Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Citation

Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002

yamir.moreno

ISA

12029045

Interaction

Regulates Rv2737c

yamir.moreno

ISA

Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay.
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Citation

Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002

yamir.moreno

IDA

12029045

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3776

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

Interaction

Regulates Rv2737c

yamir.moreno

ISO

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3074

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3370c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3395c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2719c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Interaction

Regulates Rv2720

yamir.moreno

TAS

Interaction

RegulatedBy Rv2720

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

Interaction

Regulates Rv2720

yamir.moreno

ISO

Interaction

RegulatedBy Rv2720

yamir.moreno

ISO

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Interaction

Regulates Rv2737c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv2343c

yamir.moreno

ISO

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2579

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2594c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv2703

yamir.moreno

ISO

Interaction

Regulates Rv1633

yamir.moreno

ISO

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv1638

yamir.moreno

ISO

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv1696

yamir.moreno

ISO

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1702c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2100

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv0949

yamir.moreno

ISO

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1000c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1379

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv1420

yamir.moreno

ISO

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv0058

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv0071

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv0336

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv0515

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

ISO

18985025

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv0054

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv2720

yamir.moreno

ISO

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006

Interaction

RegulatedBy Rv2720

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv2737c

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv1633

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv1638

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv1696

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv2343c

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv2703

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv0054

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv0949

yamir.moreno

ISO

Citation

Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006

yamir.moreno

ISO

16530225

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

Interaction

Regulates Rv1420

yamir.moreno

ISO

Other

TBPWY:General/ regulation

vmizrahi

Crystallization and preliminary X-ray studies of the C-terminal domain

Other

TBPWY:General/ regulation

vmizrahi

The role of multiple SOS boxes upstream of lexA investigated

Comments