TB Genome Annotation Portal

Rv2719c (-)

Amino Acid Sequence

MTPVRPPHTPDPLNLRGPLDGPRWRRAEPAQSRRPGRSRPGGAPLRYHRTGVGMSRTGHGSRPVPPATTVGLALLAAAITLWLGLVAQFGQMITGGSADG
SADSTGRVPDRLAVVRVETGESLYDVAVRVAPNAPTRQVADRIRELNGLQTPALAVGQTLIAPVG
(Nucleotide sequence available on KEGG)

Additional Information

ChiZ
cell-wall hydrolase; regulates FtsZ assembly; modulates cell division
https://www.ncbi.nlm.nih.gov/pubmed/22094151

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 5 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 5 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 5 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 5 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 5 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).
TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.

    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (    Slayden et al., 2013)

    Rv2719c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv2720ahal4789IEPCo-expression (Functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionRegulatory Rv2720ahal4789IEPCo-expression (Functional linkage)
    EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    CitationThe role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. EM. Dullaghan, PC. Brooks et al. Microbiology (Reading, Engl.) 2002ahal4789NAS12427951operon(functional linkage)
    InteractionTranscription Rv2720ahal4789NASoperon(functional linkage)
    EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
    InteractionRegulatory Rv2720ahal4789IEPCo-expression (Functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    InteractionRegulatory Rv2720ahal4789IEPCo-expression (Functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    CitationThe mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. PC. Brooks, LF. Dawson et al. J. Bacteriol. 2006ahal4789NAS16885473operon(functional linkage)
    InteractionTranscription Rv2720ahal4789NASoperon(functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    CitationDefinition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002ahal4789NAS12029045operon(functional linkage)
    InteractionTranscription Rv2720ahal4789NASoperon(functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionTranscription Rv2719cahal4789NASoperon(functional linkage)
    EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    authors,AP. Pugsley,P. Reeves Increased production of the outer membrane receptors for colicins B, D and M by Escherichia coli under iron starvation. Biochem. Biophys. Res. Commun. 1976
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    authors,JJ. Villafranca,RS. Levy,J. Kernich,T. Vickroy TPN and Mn-isocitrate protect isocitrate dehydrogenase against inactivation but increase the number of modified sulfhydryl groups. Biochem. Biophys. Res. Commun. 1977
    CitationInterference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006ahal4789NAS16942606operon(functional linkage)
    InteractionTranscription Rv2720ahal4789NASoperon(functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    MB. Mowa, DF. Warner et al. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. J. Bacteriol. 2008
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    authors,L. Wictorin,H. Fredriksson Microstructure of the solder-casting zone in bridges of dental gold alloys. Odontol Revy 1976
    InteractionTranscription Rv2717cahal4789NASoperon(functional linkage)
    PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
    InteractionTranscription Rv2717cahal4789NASoperon(functional linkage)
    authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975
    InteractionTranscription Rv2718cahal4789NASoperon(functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    InteractionTranscription Rv2717cahal4789NASoperon(functional linkage)
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    InteractionRegulatedBy Rv2720yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    SymbolchiZmjacksonIMPCell division
    NameHydrolase involved with regulation of cell divisionmjacksonIMPCell division
    SymbolchiZmjacksonIDACell division
    NameHydrolase involved with regulation of cell divisionmjacksonIDACell division
    CitationInterference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006rslayden16942606ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
    SymbolChiZrslaydenChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
    authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan ChiZ levels modulate cell division process in mycobacteria. Tuberculosis (Edinb) 2011
    Namecell wall hydrolaserslaydenChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
    authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan ChiZ levels modulate cell division process in mycobacteria. Tuberculosis (Edinb) 2011
    CitationChiZ levels modulate cell division process in mycobacteria. authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan Tuberculosis (Edinb) 2011rslayden22094151ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
    SymbolChiZrslaydenChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    Namecell wall hydrolaserslaydenChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
    A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
    OtherTBPWY:Other potential DNA repair genesvmizrahiHighly DNA damage-inducible and also induced by hydrogen peroxide stress
    OtherTBPWY:Other potential DNA repair genesvmizrahiNone

    Comments