Rv2719c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: hypothetical protein
- PATRIC: Cell division protein DivIC (FtsB) stabilizes FtsL against RasP cleavage
- TUBERCULIST: Possible conserved membrane protein
- NCBI: Possible conserved membrane protein
- updated information (H37Rv4):
  - gene name: chiZ
  - function: cell-wall hydrolase; regulates FtsZ assembly; modulates cell division
  - reference: Vedrevu (2011) PMID: 22094151
Type: Not Target
Start: 3031040
End: 3031537
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv2719c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -1.499 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTPVRPPHTPDPLNLRGPLDGPRWRRAEPAQSRRPGRSRPGGAPLRYHRTGVGMSRTGHGSRPVPPATTVGLALLAAAITLWLGLVAQFGQMITGGSADG
SADSTGRVPDRLAVVRVETGESLYDVAVRVAPNAPTRQVADRIRELNGLQTPALAVGQTLIAPVG

(Nucleotide sequence available on KEGG)

Additional Information

ChiZ
cell-wall hydrolase; regulates FtsZ assembly; modulates cell division
https://www.ncbi.nlm.nih.gov/pubmed/22094151

Analysis of Positive Selection in Clinical Isolates new

Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
- Moldova: 2,057 clinical isolates
- global set: 5,195 clinical isolates from 15 other countries
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.05 (0.48)	1.74 (0.6)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link

* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2719c/-, gene len: 497 bp, num TA sites: 5

condition	dataset	call	medium	method	notes
in-vitro	DeJesus 2017 mBio	non-essential	7H9	HMM	fully saturated, 14 TnSeq libraries combined
in-vitro	Sassetti 2003 Mol Micro	no data	7H9	TRASH	essential if hybridization ratio<0.2
in-vivo (mice)	Sassetti 2003 PNAS	non-essential	BL6 mice	TRASH	essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)	Griffin 2011 PPath	non-essential	M9 minimal+glycerol	Gumbel	2 replicates; Padj<0.05
in-vitro (cholesterol)	Griffin 2011 PPath	non-essential	M9 minimal+cholesterol	Gumbel	3 replicates; Padj<0.05
differentially essential in cholesterol	Griffin 2011 PPath	NO (LFC=-0.48)	cholesterol vs glycerol	resampling-SR	YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro	Smith 2022 eLife	non-essential	7H9	HMM	6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)	Smith 2022 eLife	non-essential	BL6 mice	HMM	6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice	Smith 2022 eLife	NO (LFC=0.3)	in-vivo vs in-vitro	ZINB	YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)	Minato 2019 mSys	non-essential	minimal medium	HMM
in-vitro (YM rich medium)	Minato 2019 mSys	non-essential	YM rich medium	HMM	7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium	Minato 2019 mSys	NO (LFC=0.26)	YM rich vs minimal medium	resampling

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1353c (-) (Direct binding)
- Rv3488 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv2720 (lexA)
- Rv3223c (sigH)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv2719c (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv2720	ahal4789	IEP		Co-expression (Functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv2720	ahal4789	IEP		Co-expression (Functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Citation	The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. EM. Dullaghan, PC. Brooks et al. Microbiology (Reading, Engl.) 2002	ahal4789	NAS	12427951	operon(functional linkage)
Interaction	Transcription Rv2720	ahal4789	NAS		operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Regulatory Rv2720	ahal4789	IEP		Co-expression (Functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Regulatory Rv2720	ahal4789	IEP		Co-expression (Functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Citation	The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. PC. Brooks, LF. Dawson et al. J. Bacteriol. 2006	ahal4789	NAS	16885473	operon(functional linkage)
Interaction	Transcription Rv2720	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Citation	Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002	ahal4789	NAS	12029045	operon(functional linkage)
Interaction	Transcription Rv2720	ahal4789	NAS		operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) authors,AP. Pugsley,P. Reeves Increased production of the outer membrane receptors for colicins B, D and M by Escherichia coli under iron starvation. Biochem. Biophys. Res. Commun. 1976
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) authors,JJ. Villafranca,RS. Levy,J. Kernich,T. Vickroy TPN and Mn-isocitrate protect isocitrate dehydrogenase against inactivation but increase the number of modified sulfhydryl groups. Biochem. Biophys. Res. Commun. 1977
Citation	Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006	ahal4789	NAS	16942606	operon(functional linkage)
Interaction	Transcription Rv2720	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) MB. Mowa, DF. Warner et al. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. J. Bacteriol. 2008
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) authors,L. Wictorin,H. Fredriksson Microstructure of the solder-casting zone in bridges of dental gold alloys. Odontol Revy 1976
Interaction	Transcription Rv2717c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2717c	ahal4789	NAS		operon(functional linkage) authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2717c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv2720	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Symbol	chiZ	mjackson	IMP		Cell division
Name	Hydrolase involved with regulation of cell division	mjackson	IMP		Cell division
Symbol	chiZ	mjackson	IDA		Cell division
Name	Hydrolase involved with regulation of cell division	mjackson	IDA		Cell division
Citation	Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006	rslayden		16942606	ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
Symbol	ChiZ	rslayden			ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan ChiZ levels modulate cell division process in mycobacteria. Tuberculosis (Edinb) 2011
Name	cell wall hydrolase	rslayden			ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan ChiZ levels modulate cell division process in mycobacteria. Tuberculosis (Edinb) 2011
Citation	ChiZ levels modulate cell division process in mycobacteria. authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan Tuberculosis (Edinb) 2011	rslayden		22094151	ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
Symbol	ChiZ	rslayden			ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Name	cell wall hydrolase	rslayden			ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Other	TBPWY:Other potential DNA repair genes	vmizrahi			Highly DNA damage-inducible and also induced by hydrogen peroxide stress
Other	TBPWY:Other potential DNA repair genes	vmizrahi			None

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Regulatory Rv2720

ahal4789

IEP

Co-expression (Functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Regulatory Rv2720

ahal4789

IEP

Co-expression (Functional linkage)
EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Citation

The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. EM. Dullaghan, PC. Brooks et al. Microbiology (Reading, Engl.) 2002

ahal4789

NAS

12427951

operon(functional linkage)

Interaction

Transcription Rv2720

ahal4789

NAS

operon(functional linkage)
EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002

Interaction

Transcription Rv2718c

ahal4789

NAS

Interaction

Transcription Rv2719c

ahal4789

NAS

Interaction

Transcription Rv2719c

ahal4789

NAS

Interaction

Regulatory Rv2720

ahal4789

IEP

Co-expression (Functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Interaction

Regulatory Rv2720

ahal4789

IEP

Co-expression (Functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Citation

The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. PC. Brooks, LF. Dawson et al. J. Bacteriol. 2006

ahal4789

NAS

16885473

operon(functional linkage)

Interaction

Transcription Rv2720

ahal4789

NAS

operon(functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Citation

Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. EO. Davis, EM. Dullaghan et al. J. Bacteriol. 2002

ahal4789

NAS

12029045

operon(functional linkage)

Interaction

Transcription Rv2720

ahal4789

NAS

operon(functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Transcription Rv2719c

ahal4789

NAS

operon(functional linkage)
EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
authors,AP. Pugsley,P. Reeves Increased production of the outer membrane receptors for colicins B, D and M by Escherichia coli under iron starvation. Biochem. Biophys. Res. Commun. 1976

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
authors,JJ. Villafranca,RS. Levy,J. Kernich,T. Vickroy TPN and Mn-isocitrate protect isocitrate dehydrogenase against inactivation but increase the number of modified sulfhydryl groups. Biochem. Biophys. Res. Commun. 1977

Citation

Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006

ahal4789

NAS

16942606

operon(functional linkage)

Interaction

Transcription Rv2720

ahal4789

NAS

operon(functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
MB. Mowa, DF. Warner et al. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. J. Bacteriol. 2008

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
authors,L. Wictorin,H. Fredriksson Microstructure of the solder-casting zone in bridges of dental gold alloys. Odontol Revy 1976

Interaction

Transcription Rv2717c

ahal4789

NAS

operon(functional linkage)
PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

Interaction

Transcription Rv2717c

ahal4789

NAS

operon(functional linkage)
authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975

Interaction

Transcription Rv2718c

ahal4789

NAS

operon(functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Interaction

Transcription Rv2717c

ahal4789

NAS

operon(functional linkage)
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Interaction

RegulatedBy Rv2720

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Symbol

chiZ

mjackson

IMP

Cell division

Name

Hydrolase involved with regulation of cell division

mjackson

IMP

Cell division

Symbol

chiZ

mjackson

IDA

Cell division

Name

Hydrolase involved with regulation of cell division

mjackson

IDA

Cell division

Citation

Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006

rslayden

16942606

ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin

Symbol

ChiZ

rslayden

ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan ChiZ levels modulate cell division process in mycobacteria. Tuberculosis (Edinb) 2011

Name

cell wall hydrolase

rslayden

Citation

ChiZ levels modulate cell division process in mycobacteria. authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan Tuberculosis (Edinb) 2011

rslayden

22094151

ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin

Symbol

ChiZ

rslayden

ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Name

cell wall hydrolase

rslayden

ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin
A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006

Other

TBPWY:Other potential DNA repair genes

vmizrahi

Highly DNA damage-inducible and also induced by hydrogen peroxide stress

Other

TBPWY:Other potential DNA repair genes

vmizrahi

None

Comments

TB Genome Annotation Portal

Rv2719c (-)

Amino Acid Sequence

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Interactions based on TFOE data (Rustad et al. 2014)

TBCAP

Comments

Analysis of Positive Selection in Clinical Isolates new