TB Genome Annotation Portal

Rv2718c (nrdR)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: transcriptional repressor NrdR
  • REFSEQ: transcriptional regulator NrdR
  • PATRIC: Ribonucleotide reductase transcriptional regulator NrdR
  • TUBERCULIST: Probable transcriptional regulatory protein NrdR
  • NCBI: Probable transcriptional regulatory protein NrdR
  • updated information (H37Rv4):
    • gene name: nrdR
    • function:
    • reference:
• Type: Not Target
• Start: 3030413
• End: 3030877
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0045892 - negative regulation of transcription, DNA-templated (Uniprot)
  • GO:0008270 - zinc ion binding (Uniprot)
  • GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
  • GO:0006351 - transcription, DNA-templated (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on nrdR:
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.902 (from Jeremy Rock's lab)

Amino Acid Sequence

MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVKRSGVTEPFSREKVISGVRRACQGRQVDDDALNLLAQQVEDSVRAAGSPEI
PSHDVGLAILGPLRELDEVAYLRFASVYRSFSSADDFAREIEALRAHRNLSAHS

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.35 (0.12)	0.79 (0.23)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link