TB Genome Annotation Portal

Rv2702 (ppgK)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: polyphosphate glucokinase
  • REFSEQ: polyphosphate glucokinase PPGK (polyphosphate-glucose phosphotransferase)
  • PATRIC: Polyphosphate glucokinase (EC 2.7.1.63)
  • TUBERCULIST: Polyphosphate glucokinase PpgK (polyphosphate-glucose phosphotransferase)
  • NCBI: Polyphosphate glucokinase PpgK (polyphosphate-glucose phosphotransferase)
  • updated information (H37Rv4):
    • gene name: ppgK
    • function:
    • reference:
• Type: Not Target
• Start: 3016858
• End: 3017655
• Operon:


• Trans-membrane region:
  
• Role: I.A.1 - Carbon compounds
• GO terms:
  • GO:0051156 - glucose 6-phosphate metabolic process (Uniprot)
  • GO:0047330 - polyphosphate-glucose phosphotransferase activity (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004340 - glucokinase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • bDGLC[c] + 40_n_41_POLYP[c] -> bDG6P[c] + 40_n_1_41_POLYP[c]
  • GLC[c] + 40_n_41_POLYP[c] -> G6P[c] + 40_n_1_41_POLYP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1WOQ	50%	Arthrobacter sp.	Crystal Structure of Inorganic Polyphosphate/ATP-Glucomannokinase From Arthrobacter sp. strain KM At 1.8 A Resolution

• Links to additional information on ppgK:
  • KEGG - nucleotide and amino acid sequences of gene
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -1.281 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAVAKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSW
IGTNARDTIGAELGGQQVTILNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAEERAASSVKEKNDWTYPKWAK
QVIRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTPVVPAALQNTAGIVGAAMASVADTTH

Additional Information