TB Genome Annotation Portal

Rv2697c (dut)

Amino Acid Sequence

VSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPA
APIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.981750;
5 non-insertions in a row out of 5 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.994000;
5 non-insertions in a row out of 5 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.994800;
5 non-insertions in a row out of 5 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.992950;
5 non-insertions in a row out of 5 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.992450;
5 non-insertions in a row out of 5 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.13
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2697c (dut)

    PropertyValueCreatorEvidencePMIDComment
    OtherTBPWY:Nucleotide poolvmizrahiCrystal structure of the mycobacterial enzyme in complex with the isosteric substrate analog, alpha,beta-imido-dUTP and Mg(2+) at 1.5A resolution was determined that visualizes the full-length C-terminus. Interactions of a conserved motif important in catalysis, the Mycobacterium-specific five-residue-loop insert and C-terminal tetrapeptide described.
    OtherTBPWY:Nucleotide poolvmizrahiK(d) for alpha,beta-imido-dUTP binding to Mtb dUTPase is 10-fold less than for human dUTPase
    CitationCrystal structure of the Mycobacterium tuberculosis dUTPase: insights into the catalytic mechanism. authors,S. Chan,B. Segelke,T. Lekin,H. Krupka,US. Cho,MY. Kim,M. So,CY. Kim,CM. Naranjo,YC. Rogers,MS. Park,GS. Waldo,I. Pashkov,D. Cascio,JL. Perry,MR. Sawaya J. Mol. Biol. 2004jjmcfadden15276840Inferred from direct assay
    TermEC:3.6.1.23 dUTP diphosphatase. - NRjjmcfaddenNRInferred from direct assay
    authors,S. Chan,B. Segelke,T. Lekin,H. Krupka,US. Cho,MY. Kim,M. So,CY. Kim,CM. Naranjo,YC. Rogers,MS. Park,GS. Waldo,I. Pashkov,D. Cascio,JL. Perry,MR. Sawaya Crystal structure of the Mycobacterium tuberculosis dUTPase: insights into the catalytic mechanism. J. Mol. Biol. 2004

    Comments