TB Genome Annotation Portal

Rv2673 (aftC)

Amino Acid Sequence

VYGALVTAADSIRTGLGASLLAGFRPRTGAPSTATILRSALWPAAVLSVLHRSIVLTTNGNITDDFKPVYRAVLNFRRGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPFAPSRYLFISINTAAILVAAYLLLRMFNFTLTSVAAPALILAMFATETVTNTLVFTNINGCILLLEVLFLRWLLDGRASRQWCGGLAIG
LTLVLKPLLGPLLLLPLLNRQWRALVAAVVVPVVVNVAALPLVSDPMSFFTRTLPYILGTRDYFNSSILGNGVYFGLPTWLILFLRILFTAITFGALWLL
YRYYRTGDPLFWFTTSSGVLLLWSWLVMSLAQGYYSMMLFPFLMTVVLPNSVIRNWPAWLGVYGFMTLDRWLLFNWMRWGRALEYLKITYGWSLLLIVTF
TVLYFRYLDAKADNRLDGGIDPAWLTPEREGQR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2673/aftC, gene len: 1301 bp, num TA sites: 29
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-1.11)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.011)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.59)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)0.88 (0.29)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2673/aftCRv0818/glnR-1.11
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2673 (aftC)

    PropertyValueCreatorEvidencePMIDComment
    SymbolaftCmjacksonIMPPIM, LM and LAM biosynthesis
    NameDecaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAMmjacksonIMPPIM, LM and LAM biosynthesis
    SymbolaftCmjacksonIDAPIM, LM and LAM biosynthesis
    NameDecaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAMmjacksonIDAPIM, LM and LAM biosynthesis
    SymbolaftCmjacksonDecaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    HL. Birch,LJ. Alderwick,BJ. Appelmelk,J. Maaskant,A. Bhatt,A. Singh,J. Nigou,L. Eggeling,J. Geurtsen,GS. Besra A truncated lipoglycan from mycobacteria with altered immunological properties. Proc. Natl. Acad. Sci. U.S.A. 2010
    CitationA truncated lipoglycan from mycobacteria with altered immunological properties. HL. Birch,LJ. Alderwick,BJ. Appelmelk,J. Maaskant,A. Bhatt,A. Singh,J. Nigou,L. Eggeling,J. Geurtsen,GS. Besra Proc. Natl. Acad. Sci. U.S.A. 2010mjackson20133807Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:PIM, LM and LAM biosynthesismjacksonDecaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    HL. Birch,LJ. Alderwick,BJ. Appelmelk,J. Maaskant,A. Bhatt,A. Singh,J. Nigou,L. Eggeling,J. Geurtsen,GS. Besra A truncated lipoglycan from mycobacteria with altered immunological properties. Proc. Natl. Acad. Sci. U.S.A. 2010
    SymbolaftCmjacksonDecaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    HL. Birch, LJ. Alderwick et al. Biosynthesis of mycobacterial arabinogalactan: identification of a novel alpha(1-->3) arabinofuranosyltransferase. Mol. Microbiol. 2008
    CitationBiosynthesis of mycobacterial arabinogalactan: identification of a novel alpha(1-->3) arabinofuranosyltransferase. HL. Birch, LJ. Alderwick et al. Mol. Microbiol. 2008mjackson18627460Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:PIM, LM and LAM biosynthesismjacksonDecaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    HL. Birch, LJ. Alderwick et al. Biosynthesis of mycobacterial arabinogalactan: identification of a novel alpha(1-->3) arabinofuranosyltransferase. Mol. Microbiol. 2008
    SymbolaftCmjacksonDecaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,J. Zhang,SK. Angala,PK. Pramanik,K. Li,DC. Crick,A. Liav,A. Jozwiak,E. Swiezewska,M. Jackson,D. Chatterjee Reconstitution of functional mycobacterial arabinosyltransferase AftC proteoliposome and assessment of decaprenylphosphorylarabinose analogues as arabinofuranosyl donors. ACS Chem. Biol. 2011
    CitationReconstitution of functional mycobacterial arabinosyltransferase AftC proteoliposome and assessment of decaprenylphosphorylarabinose analogues as arabinofuranosyl donors. authors,J. Zhang,SK. Angala,PK. Pramanik,K. Li,DC. Crick,A. Liav,A. Jozwiak,E. Swiezewska,M. Jackson,D. Chatterjee ACS Chem. Biol. 2011mjackson21595486Decaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:PIM, LM and LAM biosynthesismjacksonDecaprenol phosphoarabinose-dependent alpha-1,3-branching arabinosyltransferase involved in the biosynthesis of arabinogalactan and LAM (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,J. Zhang,SK. Angala,PK. Pramanik,K. Li,DC. Crick,A. Liav,A. Jozwiak,E. Swiezewska,M. Jackson,D. Chatterjee Reconstitution of functional mycobacterial arabinosyltransferase AftC proteoliposome and assessment of decaprenylphosphorylarabinose analogues as arabinofuranosyl donors. ACS Chem. Biol. 2011

    Comments