Rv2610c (pimA)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
REFSEQ: alpha-mannosyltransferase PIMA
PATRIC: Phosphatidylinositol alpha-mannosyltransferase (EC 2.4.1.57)
TUBERCULIST: Alpha-mannosyltransferase PimA
NCBI: Alpha-mannosyltransferase PimA
updated information (H37Rv4):
gene name: pimA
function:
reference:
Coordinates in H37Rv: 2937865 - 2939001
Gene length: 1137 bp (with stop codon), 378 aa (without stop codon)
Operon:
Trans-membrane region:
Role: IV.H - Miscellaneous transferases
GO terms:
GO:0097502 - mannosylation (Uniprot)
GO:0046488 - phosphatidylinositol metabolic process (Uniprot)
GO:0043750 - phosphatidylinositol alpha-mannosyltransferase activity (Uniprot)
GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
GO:0016740 - transferase activity (Uniprot)
GO:0016020 - membrane (Uniprot)
GO:0009405 - pathogenesis (Uniprot)
GO:0009247 - glycolipid biosynthetic process (Uniprot)
GO:0008654 - phospholipid biosynthetic process (Uniprot)
GO:0006629 - lipid metabolic process (Uniprot)
GO:0005886 - plasma membrane (Uniprot)
GO:0004377 - GDP-Man:Man3GlcNAc2-PP-Dol alpha-1,2-mannosyltransferase activity (Uniprot)
GO:0000287 - magnesium ion binding (Uniprot)
GO:0000030 - mannosyltransferase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 4NC9 82% Mycobacterium smegmatis Crystal structure of phosphatidyl mannosyltransferase PimA 4N9W 82% Mycobacterium smegmatis Crystal structure of phosphatidyl mannosyltransferase PimA 2GEK 82% Mycobacterium smegmatis Crystal Structure of phosphatidylinositol mannosyltransferase (PimA) from Mycobacterium smegmatis in complex with GDP 2GEJ 82% Mycobacterium smegmatis Crystal Structure of phosphatidylinositol mannosyltransferase (PimA) from Mycobacterium smegmatis in complex with GDP-Man
Links to additional information on pimA:
Amino Acid Sequence
MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPS
LSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEP
RKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRR
VLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYETVAGSGAKVQVAS
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv2610c/pimA,
gene len: 1136 bp, num TA sites: 16
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro no data 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=0.0) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.0) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.0) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv2610c: 0.488538915
lineage-specific pN/pS in L1: 0.653996906
lineage-specific pN/pS in L2: 0.465294241
lineage-specific pN/pS in L3: 0.767950912
lineage-specific pN/pS in L4: 0.385037139
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 2.41 (0.94)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Citation Identification of the required acyltransferase step in the biosynthesis of the phosphatidylinositol mannosides of mycobacterium species. J. Kordulkov, M. Gilleron et al. J. Biol. Chem. 2003 njamshidi ISS 12851411 known to occur physiologically see for example PMID: 12851411
Term EC:2.4.1.131 GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase. - ISS njamshidi ISS 12851411 known to occur physiologically see for example PMID: 12851411J. Kordulkov, M. Gilleron et al. Identification of the required acyltransferase step in the biosynthesis of the phosphatidylinositol mannosides of mycobacterium species. J. Biol. Chem. 2003
Term TBRXN:G16MTM1 Glycolipid 1,6-alpha-D-mannosyltransferase - ISS njamshidi ISS 12851411 known to occur physiologically see for example PMID: 12851411J. Kordulkov, M. Gilleron et al. Identification of the required acyltransferase step in the biosynthesis of the phosphatidylinositol mannosides of mycobacterium species. J. Biol. Chem. 2003
Citation Identification of the required acyltransferase step in the biosynthesis of the phosphatidylinositol mannosides of mycobacterium species. J. Kordulkov, M. Gilleron et al. J. Biol. Chem. 2003 njamshidi IPI 12851411 known to occur physiologically see for example PMID: 12851411
Term EC:2.4.1.131 GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase. - IPI njamshidi IPI 12851411 known to occur physiologically see for example PMID: 12851411J. Kordulkov, M. Gilleron et al. Identification of the required acyltransferase step in the biosynthesis of the phosphatidylinositol mannosides of mycobacterium species. J. Biol. Chem. 2003
Term TBRXN:G16MTM1 Glycolipid 1,6-alpha-D-mannosyltransferase - IPI njamshidi IPI 12851411 known to occur physiologically see for example PMID: 12851411J. Kordulkov, M. Gilleron et al. Identification of the required acyltransferase step in the biosynthesis of the phosphatidylinositol mannosides of mycobacterium species. J. Biol. Chem. 2003
Interaction PhysicalInteraction Rv2611c shahanup86 NAS Operon (Functional linkage)authors,PJ. Brennan Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. Tuberculosis (Edinb) 2003
Interaction PhysicalInteraction Rv2609c shahanup86 NAS Operon (Functional linkage)authors,PJ. Brennan Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. Tuberculosis (Edinb) 2003
Citation Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. authors,PJ. Brennan Tuberculosis (Edinb) 2003 shahanup86 NAS 12758196 Operon (Functional linkage)
Interaction PhysicalInteraction Rv2609c shahanup86 NAS Operon (Functional linkage)authors,PJ. Brennan Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. Tuberculosis (Edinb) 2003
Interaction PhysicalInteraction Rv2611c shahanup86 NAS Operon (Functional linkage)authors,PJ. Brennan Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. Tuberculosis (Edinb) 2003
Name GDP-Man-dependent alpha-1,2-phosphatidylinositol mannosyltransferase; essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished result) mjackson IMP PIM, LM and LAM biosynthesis
Name GDP-Man-dependent alpha-1,2-phosphatidylinositol mannosyltransferase; essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished result) mjackson IDA PIM, LM and LAM biosynthesis
Citation Definition of the first mannosylation step in phosphatidylinositol mannoside synthesis. PimA is essential for growth of mycobacteria. J. Kordulkov, M. Gilleron et al. J. Biol. Chem. 2002 mjackson 12068013 GDP-Man-dependent alpha-1,2-phosphatidylinositol mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic); essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson GDP-Man-dependent alpha-1,2-phosphatidylinositol mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic); essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished)J. Kordulkov, M. Gilleron et al. Definition of the first mannosylation step in phosphatidylinositol mannoside synthesis. PimA is essential for growth of mycobacteria. J. Biol. Chem. 2002
Citation New insights into the early steps of phosphatidylinositol mannoside biosynthesis in mycobacteria: PimB' is an essential enzyme of Mycobacterium smegmatis. ME. Guerin, D. Kaur et al. J. Biol. Chem. 2009 mjackson 19638342 GDP-Man-dependent alpha-1,2-phosphatidylinositol mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic); essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson GDP-Man-dependent alpha-1,2-phosphatidylinositol mannosyltransferase (phenotypic [mycobacterial recombinant strains]; enzymatic); essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished)ME. Guerin, D. Kaur et al. New insights into the early steps of phosphatidylinositol mannoside biosynthesis in mycobacteria: PimB' is an essential enzyme of Mycobacterium smegmatis. J. Biol. Chem. 2009