Rv2605c (tesB2)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: acyl-CoA thioesterase II
REFSEQ: acyl-CoA thioesterase II
PATRIC: Acyl-CoA thioesterase II (EC 3.1.2.-)
TUBERCULIST: Probable acyl-CoA thioesterase II TesB2 (TEII)
NCBI: Probable acyl-CoA thioesterase II TesB2 (TEII)
updated information (H37Rv4):
gene name: tesB2
function:
reference:
Coordinates in H37Rv: 2932297 - 2933142
Gene length: 846 bp (with stop codon), 281 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.H.1 - Synthesis of fatty and mycolic acids
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): PDB aa ident species PDB title 3U0A 85% Mycobacterium marinum Crystal structure of an Acyl-CoA thioesterase II TesB2 from Mycobacterium marinum 1C8U 41% Escherichia coli CRYSTAL STRUCTURE OF THE E.COLI THIOESTERASE II, A HOMOLOGUE OF THE HUMAN NEF-BINDING ENZYME 4R4U 41% Yersinia pestis Crystal structure of acyl-CoA thioesterase tesB from Yersinia pestis in complex with coenzyme A 4QFW 41% Yersinia pestis Crystal structure of acyl-CoA thioesterase tesB from Yersinia pestis 4R9Z 35% Mycobacterium avium subsp. paratuberculosis Mycobacterium avium subs paratuberculosis tesB protein MAP1729c 3RD7 35% Mycobacterium avium Crystal structure of acyl-coa thioesterase from mycobacterium avium
Links to additional information on tesB2:
Amino Acid Sequence
VSIEEILDLEQLEVNIYRGSVFSPESGFLQRTFGGHVAGQSLVSAVRTVDPRYMVHSLHGYFLRPGDAKERTVFLVERIRDGGSFCTRRVNAVQHGETIF
SMAASFQTEQEGITHQDVMPAAPPPDGLPGLNSIKVFDDAGFRQFDEWDVCIVPRERLRLLPGKASQQQVWLRHRDPLPDDPVLHICALAYMSDLTLLGS
AQVNHLDVRDQLQVASLDHAMWFMRPFRADEWLLYDQSSPSASGGRALTRGEIFTRSGEMVAAVMQEGLTRHRRGHRSVGQ
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv2605c/tesB2,
gene len: 845 bp, num TA sites: 9
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-1.58) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife YES (LFC=-1.858) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-0.78) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv2605c: 0.685198188
lineage-specific pN/pS in L1: 0.671762929
lineage-specific pN/pS in L2: 0.763366965
lineage-specific pN/pS in L3: 0.732832287
lineage-specific pN/pS in L4: 0.660857687
Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods )
Moldova: 2,057 clinical isolates
global set: 5,195 clinical isolates from 15 other countries
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
Moldova (2,057) global set (5,195)
under significant positive selection? NO NO
omega peak height (95%CI lower bound) 1.71 (0.26) 0.93 (0.39)
codons under selection
omega plots
genetic variants* link link
statistics at each codon link link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Citation Towards the proteome of Mycobacterium tuberculosis. authors,I. Rosenkrands,A. King,K. Weldingh,M. Moniatte,E. Moertz,P. Andersen Electrophoresis 2000 njamshidi ISS 12657046|11271494 See PMID: 12657046, 11271494. As per TubercuList this believed to hydrolyze a wide range of acyl-coa thioesters
Term TBRXN:FCOAH2 formyl coa hydrolase - ISS njamshidi ISS 12657046|11271494 See PMID: 12657046, 11271494. As per TubercuList this believed to hydrolyze a wide range of acyl-coa thioestersauthors,I. Rosenkrands,A. King,K. Weldingh,M. Moniatte,E. Moertz,P. Andersen Towards the proteome of Mycobacterium tuberculosis. Electrophoresis 2000
Citation Genes required for mycobacterial growth defined by high density mutagenesis. authors,CM. Sassetti,DH. Boyd,EJ. Rubin Mol. Microbiol. 2003 njamshidi IPI 12657046|11271494 See PMID: 12657046, 11271494. As per TubercuList this believed to hydrolyze a wide range of acyl-coa thioesters
Term TBRXN:FCOAH2 formyl coa hydrolase - IPI njamshidi IPI 12657046|11271494 See PMID: 12657046, 11271494. As per TubercuList this believed to hydrolyze a wide range of acyl-coa thioestersauthors,CM. Sassetti,DH. Boyd,EJ. Rubin Genes required for mycobacterial growth defined by high density mutagenesis. Mol. Microbiol. 2003
Citation Towards the proteome of Mycobacterium tuberculosis. authors,I. Rosenkrands,A. King,K. Weldingh,M. Moniatte,E. Moertz,P. Andersen Electrophoresis 2000 njamshidi IPI 12657046|11271494 See PMID: 12657046, 11271494. As per TubercuList this believed to hydrolyze a wide range of acyl-coa thioesters
Term TBRXN:FCOAH2 formyl coa hydrolase - IPI njamshidi IPI 12657046|11271494 See PMID: 12657046, 11271494. As per TubercuList this believed to hydrolyze a wide range of acyl-coa thioestersauthors,I. Rosenkrands,A. King,K. Weldingh,M. Moniatte,E. Moertz,P. Andersen Towards the proteome of Mycobacterium tuberculosis. Electrophoresis 2000
Citation Genes required for mycobacterial growth defined by high density mutagenesis. authors,CM. Sassetti,DH. Boyd,EJ. Rubin Mol. Microbiol. 2003 njamshidi ISS 12657046|11271494 See PMID: 12657046, 11271494. As per TubercuList this believed to hydrolyze a wide range of acyl-coa thioesters
Term TBRXN:FCOAH2 formyl coa hydrolase - ISS njamshidi ISS 12657046|11271494 See PMID: 12657046, 11271494. As per TubercuList this believed to hydrolyze a wide range of acyl-coa thioestersauthors,CM. Sassetti,DH. Boyd,EJ. Rubin Genes required for mycobacterial growth defined by high density mutagenesis. Mol. Microbiol. 2003