TB Genome Annotation Portal

Rv2596 (vapC40)

Amino Acid Sequence

VIAPDTSVLVAGFATWHEGHEAAVRALNRGVHLIAHAAVETYSVLTRLPPPHRIAPVAVHAYLADITSSNYLALDACSYRGLTDHLAEHDVTGGATYDAL
VGFTAKAAGAKLLTRDLRAVETYERLRVEVELVT
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2596/vapC40, gene len: 404 bp, num TA sites: 8
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth advantage7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.53)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.252)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.17)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.24 (0.54)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2596/vapC40Rv2595/vapB401.24
    Rv2596/vapC40Rv2887/--1.16
    Rv2596/vapC40Rv0324/--1.66


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2596 (vapC40)

    PropertyValueCreatorEvidencePMIDComment
    InteractionOperon Rv2595xaccheusTASStructural Analysis
    authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
    CitationDistant structural homology leads to the functional characterization of an archaeal PIN domain as an exonuclease. authors,VL. Arcus,K. Bckbro,A. Roos,EL. Daniel,EN. Baker J. Biol. Chem. 2004xaccheusTAS14734548Spectrophotometric
    InteractionOperon Rv2595xaccheusTASSpectrophotometric
    authors,VL. Arcus,K. Bckbro,A. Roos,EL. Daniel,EN. Baker Distant structural homology leads to the functional characterization of an archaeal PIN domain as an exonuclease. J. Biol. Chem. 2004
    CitationDistant structural homology leads to the functional characterization of an archaeal PIN domain as an exonuclease. authors,VL. Arcus,K. Bckbro,A. Roos,EL. Daniel,EN. Baker J. Biol. Chem. 2004xaccheusTAS14734548Structural Analysis
    InteractionOperon Rv2595xaccheusTASStructural Analysis
    authors,VL. Arcus,K. Bckbro,A. Roos,EL. Daniel,EN. Baker Distant structural homology leads to the functional characterization of an archaeal PIN domain as an exonuclease. J. Biol. Chem. 2004
    InteractionOperon Rv2595xaccheusTASSpectrophotometric
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    InteractionOperon Rv2595xaccheusTASSpectrophotometric
    authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
    InteractionOperon Rv2595xaccheusTASStructural Analysis
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009jlew20011113VapC homolog, PIN domain, Not toxic when expressed in Msmeg
    SymbolvapC-mt25jlewNo growth when mazF-mt1 expressed in Ecoli but restored when mazE-mt1 was co-induced. mazF-mt1 could also be partially neutralized by vapB-mt24 or vapB-mt25. Growth inhibition by mazF-mt3; normal growth if mazE-mt1, mazE-mt3, vapB-mt24 or vapB-mt25 were co-expressed. Each pair shows interaction by pull-down.
    authors,L. Zhu,JD. Sharp,H. Kobayashi,NA. Woychik,M. Inouye Noncognate Mycobacterium tuberculosis toxin-antitoxins can physically and functionally interact. J. Biol. Chem. 2010
    CitationNoncognate Mycobacterium tuberculosis toxin-antitoxins can physically and functionally interact. authors,L. Zhu,JD. Sharp,H. Kobayashi,NA. Woychik,M. Inouye J. Biol. Chem. 2010jlew20876537No growth when mazF-mt1 expressed in Ecoli but restored when mazE-mt1 was co-induced. mazF-mt1 could also be partially neutralized by vapB-mt24 or vapB-mt25. Growth inhibition by mazF-mt3; normal growth if mazE-mt1, mazE-mt3, vapB-mt24 or vapB-mt25 were co-expressed. Each pair shows interaction by pull-down.

    Comments