TB Genome Annotation Portal

Rv2593c (ruvA)

Amino Acid Sequence

MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQV
LADGNVAALTRVPGIGKRGAERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKAR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.914750;
6 non-insertions in a row out of 6 sites
Uncertain Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.977050;
6 non-insertions in a row out of 6 sites
Uncertain Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.982450;
6 non-insertions in a row out of 6 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000500;
3 non-insertions in a row out of 6 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000350;
3 non-insertions in a row out of 6 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Growth-Defect 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2593c (ruvA)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
    InteractionPhysicalInteraction Rv2603csureshks89ISA
    authors,MY. Galperin,EV. Koonin From complete genome sequence to 'complete' understanding? Trends Biotechnol. 2010
    InteractionPhysicalInteraction Rv2603csureshks89ISA
    authors,H. Liang,L. Li,Z. Dong,MG. Surette,K. Duan The YebC family protein PA0964 negatively regulates the Pseudomonas aeruginosa quinolone signal system and pyocyanin production. J. Bacteriol. 2008
    InteractionPhysicalInteraction Rv2594cshahanup86IEPCo-expression (Functional linkage)
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2594cshahanup86IEPCo-expression (Functional linkage)
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionPhysicalInteraction Rv2594cshahanup86IEPCo-expression (Functional linkage)
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2594cshahanup86IEPCo-expression (Functional linkage)
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
    CitationMycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). JS. Khanduja, P. Tripathi et al. Biochemistry 2008shahanup86IDA19072585Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
    CitationThe role of RuvA octamerization for RuvAB function in vitro and in vivo. authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva J. Biol. Chem. 2005shahanup86IDA15556943Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
    CitationStructure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. JR. Prabu, S. Thamotharan et al. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006shahanup86IDA16880543Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    CitationIdentification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. PC. Brooks, F. Movahedzadeh et al. J. Bacteriol. 2001shahanup86IDA11443079Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    CitationCrystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. JR. Prabu, S. Thamotharan et al. Biochim. Biophys. Acta 2009shahanup86IDA19374958Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
    OtherTBPWY:Recombination repairvmizrahiDNA Replication Fork Reversal Catalyzed by RuvAB Proteins functionally characterized
    OtherTBPWY:Recombination repairvmizrahiCrystallographic and modelling studies on Mycobacterium tuberculosis RuvA
    OtherTBPWY:Recombination repairvmizrahiRuvA induces two distinct types of structural distortions between the homologous and heterologous Holliday junctions.
    OtherTBPWY:Recombination repairvmizrahiIncreased expression in Mtb from clinical lung samples

    Comments