TB Genome Annotation Portal

Rv2593c (ruvA)

Amino Acid Sequence

MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQV
LADGNVAALTRVPGIGKRGAERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKAR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2593c/ruvA, gene len: 590 bp, num TA sites: 6
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth defect7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-1.97)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.047)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-3.04)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)0.67 (0.29)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2593c/ruvARv0078/--1.15
    Rv2593c/ruvARv2242/mabR-1.28
    Rv2593c/ruvARv2720/lexA-1.36
    Rv2593c/ruvARv0324/--1.49
    Rv2593c/ruvARv0022c/whiB5-2.01
    Rv2593c/ruvARv3223c/sigH-2.89


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2593c (ruvA)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
    InteractionPhysicalInteraction Rv2603csureshks89ISA
    authors,MY. Galperin,EV. Koonin From complete genome sequence to 'complete' understanding? Trends Biotechnol. 2010
    InteractionPhysicalInteraction Rv2603csureshks89ISA
    authors,H. Liang,L. Li,Z. Dong,MG. Surette,K. Duan The YebC family protein PA0964 negatively regulates the Pseudomonas aeruginosa quinolone signal system and pyocyanin production. J. Bacteriol. 2008
    InteractionPhysicalInteraction Rv2594cshahanup86IEPCo-expression (Functional linkage)
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2594cshahanup86IEPCo-expression (Functional linkage)
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionPhysicalInteraction Rv2594cshahanup86IEPCo-expression (Functional linkage)
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2594cshahanup86IEPCo-expression (Functional linkage)
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
    CitationMycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). JS. Khanduja, P. Tripathi et al. Biochemistry 2008shahanup86IDA19072585Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
    CitationThe role of RuvA octamerization for RuvAB function in vitro and in vivo. authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva J. Biol. Chem. 2005shahanup86IDA15556943Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
    CitationStructure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. JR. Prabu, S. Thamotharan et al. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006shahanup86IDA16880543Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    CitationIdentification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. PC. Brooks, F. Movahedzadeh et al. J. Bacteriol. 2001shahanup86IDA11443079Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionPhysicalInteraction Rv2594cshahanup86IDAStructural Analysis
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    CitationCrystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. JR. Prabu, S. Thamotharan et al. Biochim. Biophys. Acta 2009shahanup86IDA19374958Structural Analysis
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
    InteractionPhysicalInteraction Rv2592cshahanup86IDAStructural Analysis
    JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
    OtherTBPWY:Recombination repairvmizrahiDNA Replication Fork Reversal Catalyzed by RuvAB Proteins functionally characterized
    OtherTBPWY:Recombination repairvmizrahiCrystallographic and modelling studies on Mycobacterium tuberculosis RuvA
    OtherTBPWY:Recombination repairvmizrahiRuvA induces two distinct types of structural distortions between the homologous and heterologous Holliday junctions.
    OtherTBPWY:Recombination repairvmizrahiIncreased expression in Mtb from clinical lung samples

    Comments