Rv2590 (fadD9)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: thioester reductase domain-containing protein
- REFSEQ: fatty-acid-CoA ligase
- PATRIC: Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)
- TUBERCULIST: Probable fatty-acid-CoA ligase FadD9 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)
- NCBI: Probable fatty-acid-CoA ligase FadD9 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)
- updated information (H37Rv4):
  - gene name: fadD9
  - function:
  - reference:
Type: Not Target
Start: 2917871
End: 2921377
Operon:

Trans-membrane region:
Role: I.A.3 - Fatty acids
GO terms:
- GO:0031177 - phosphopantetheine binding (Uniprot)
- GO:0016874 - ligase activity (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0003824 - catalytic activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
5MSU	75%	Mycobacterium marinum M	Structure of the R domain of carboxylic acid reductase (CAR) from Mycobacterium marinum in complex with NADP, P21 form
5MSO	75%	Mycobacterium marinum M	Structure of the R domain of carboxylic acid reductase (CAR) from Mycobacterium marinum in complex with NADP
4U5Q	65%	Mycobacterium tuberculosis	High resolution crystal structure of reductase (R) domain of nonribosomal peptide synthetase from Mycobacterium tuberculosis
4DQV	65%	Mycobacterium tuberculosis	Crystal structure of reductase (R) domain of non-ribosomal peptide synthetase from Mycobacterium tuberculosis
5MSQ	60%	Nocardia iowensis	Structure of the A domain of carboxylic acid reductase (CAR) from Nocardia iowensis in complex with AMP and iodide
5MSD	60%	Nocardia iowensis	Structure of the A domain of carboxylic acid reductase (CAR) from Nocardia iowensis in complex with AMP and benzoic acid
5MSC	60%	Nocardia iowensis	Structure of the A domain of carboxylic acid reductase (CAR) from Nocardia iowensis in complex with AMP
5MSW	57%	Segniliparus rugosus ATCC BAA-974	Structure of the A-PCP didomain of carboxylic acid reductase (CAR) from Segniliparus rugosus in complex with AMP
5MSV	57%	Segniliparus rugosus ATCC BAA-974	Structure of the phosphopantetheine modified PCP-R didomain of carboxylic acid reductase (CAR) in complex with NADP
5MST	57%	Segniliparus rugosus ATCC BAA-974	Structure of the A domain of carboxylic acid reductase (CAR) from Segniliparus rugosus in complex with AMP and a co-purified carboxylic acid

Links to additional information on fadD9:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.537 (from Jeremy Rock's lab)

Amino Acid Sequence

MSINDQRLTRRVEDLYASDAQFAAASPNEAITQAIDQPGVALPQLIRMVMEGYADRPALGQRALRFVTDPDSGRTMVELLPRFETITYRELWARAGTLAT
ALSAEPAIRPGDRVCVLGFNSVDYTTIDIALIRLGAVSVPLQTSAPVTGLRPIVTETEPTMIATSIDNLGDAVEVLAGHAPARLVVFDYHGKVDTHREAV
EAARARLAGSVTIDTLAELIERGRALPATPIADSADDALALLIYTSGSTGAPKGAMYRESQVMSFWRKSSGWFEPSGYPSITLNFMPMSHVGGRQVLYGT
LSNGGTAYFVAKSDLSTLFEDLALVRPTELCFVPRIWDMVFAEFHSEVDRRLVDGADRAALEAQVKAELRENVLGGRFVMALTGSAPISAEMTAWVESLL
ADVHLVEGYGSTEAGMVLNDGMVRRPAVIDYKLVDVPELGYFGTDQPYPRGELLVKTQTMFPGYYQRPDVTAEVFDPDGFYRTGDIMAKVGPDQFVYLDR
RNNVLKLSQGEFIAVSKLEAVFGDSPLVRQIFIYGNSARAYPLAVVVPSGDALSRHGIENLKPVISESLQEVARAAGLQSYEIPRDFIIETTPFTLENGL
LTGIRKLARPQLKKFYGERLERLYTELADSQSNELRELRQSGPDAPVLPTLCRAAAALLGSTAADVRPDAHFADLGGDSLSALSLANLLHEIFGVDVPVG
VIVSPASDLRALADHIEAARTGVRRPSFASIHGRSATEVHASDLTLDKFIDAATLAAAPNLPAPSAQVRTVLLTGATGFLGRYLALEWLDRMDLVNGKLI
CLVRARSDEEAQARLDATFDSGDPYLVRHYRELGAGRLEVLAGDKGEADLGLDRVTWQRLADTVDLIVDPAALVNHVLPYSQLFGPNAAGTAELLRLALT
GKRKPYIYTSTIAVGEQIPPEAFTEDADIRAISPTRRIDDSYANGYANSKWAGEVLLREAHEQCGLPVTVFRCDMILADTSYTGQLNLPDMFTRLMLSLA
ATGIAPGSFYELDAHGNRQRAHYDGLPVEFVAEAICTLGTHSPDRFVTYHVMNPYDDGIGLDEFVDWLNSPTSGSGCTIQRIADYGEWLQRFETSLRALP
DRQRHASLLPLLHNYREPAKPICGSIAPTDQFRAAVQEAKIGPDKDIPHLTAAIIAKYISNLRLLGLL

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 62 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 62 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 62 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 62 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 62 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.31
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0081 (-) (Direct binding)
- Rv0757 (phoP) (Direct binding)
- Rv0880 (-) (Direct binding)
- Rv3597c (lsr2) (Direct binding)
- Rv3681c (whiB4) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0757 (phoP)
- Rv0818 (-)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0880 (-)
- Rv3416 (whiB3)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv2590 (fadD9)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv3678c	hibeeluck	IPI		Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv3169	hibeeluck	IPI		Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv3678c	hibeeluck	IPI		Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Citation	Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mol. Biol. Cell 2005	hibeeluck	IPI	15525680	Yeast one Hybrid
Interaction	Regulatory Rv2021c	hibeeluck	IPI		Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv2710	hibeeluck	IPI		Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv3133c	hibeeluck	IPI		Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv3169	hibeeluck	IPI		Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv2710	hibeeluck	IPI		Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv3133c	hibeeluck	IPI		Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv3169	hibeeluck	IPI		Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv3678c	hibeeluck	IPI		Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Citation	PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. J. Gonzalo-Asensio, S. Mostowy et al. PLoS ONE 2008	hibeeluck	IPI	18946503	Yeast one Hybrid
Interaction	Regulatory Rv2021c	hibeeluck	IPI		Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv2710	hibeeluck	IPI		Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv3133c	hibeeluck	IPI		Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	hibeeluck	IPI	19228590	Yeast one Hybrid
Interaction	Regulatory Rv2021c	hibeeluck	IPI		Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2710	hibeeluck	IPI		Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3133c	hibeeluck	IPI		Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3169	hibeeluck	IPI		Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3678c	hibeeluck	IPI		Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. R. Manganelli, MI. Voskuil et al. Mol. Microbiol. 2001	hibeeluck	IPI	11489128	Yeast one Hybrid
Interaction	Regulatory Rv2021c	hibeeluck	IPI		Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv3678c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3164c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2710	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2021c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Regulatory Rv3678c

hibeeluck

IPI

Yeast one Hybrid
authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005

Interaction

Regulatory Rv3169

hibeeluck

IPI

Yeast one Hybrid
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Interaction

Regulatory Rv3678c

hibeeluck

IPI

Yeast one Hybrid
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Citation

Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mol. Biol. Cell 2005

hibeeluck

IPI

15525680

Yeast one Hybrid

Interaction

Regulatory Rv2021c

hibeeluck

IPI

Interaction

Regulatory Rv2710

hibeeluck

IPI

Interaction

Regulatory Rv3133c

hibeeluck

IPI

Interaction

Regulatory Rv3169

hibeeluck

IPI

Interaction

Regulatory Rv2710

hibeeluck

IPI

Yeast one Hybrid
R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001

Interaction

Regulatory Rv3133c

hibeeluck

IPI

Yeast one Hybrid
R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001

Interaction

Regulatory Rv3169

hibeeluck

IPI

Yeast one Hybrid
R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001

Interaction

Regulatory Rv3678c

hibeeluck

IPI

Yeast one Hybrid
R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001

Citation

PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. J. Gonzalo-Asensio, S. Mostowy et al. PLoS ONE 2008

hibeeluck

IPI

18946503

Yeast one Hybrid

Interaction

Regulatory Rv2021c

hibeeluck

IPI

Yeast one Hybrid
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Interaction

Regulatory Rv2710

hibeeluck

IPI

Yeast one Hybrid
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Interaction

Regulatory Rv3133c

hibeeluck

IPI

Yeast one Hybrid
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

hibeeluck

IPI

19228590

Yeast one Hybrid

Interaction

Regulatory Rv2021c

hibeeluck

IPI

Yeast one Hybrid
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2710

hibeeluck

IPI

Yeast one Hybrid
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv3133c

hibeeluck

IPI

Yeast one Hybrid
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv3169

hibeeluck

IPI

Yeast one Hybrid
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv3678c

hibeeluck

IPI

Yeast one Hybrid
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Citation

The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. R. Manganelli, MI. Voskuil et al. Mol. Microbiol. 2001

hibeeluck

IPI

11489128

Yeast one Hybrid

Interaction

Regulatory Rv2021c

hibeeluck

IPI

Yeast one Hybrid
R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Interaction

RegulatedBy Rv3678c

yamir.moreno

IDA

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

RegulatedBy Rv3164c

yamir.moreno

IDA

Interaction

RegulatedBy Rv3133c

yamir.moreno

IDA

Interaction

RegulatedBy Rv2710

yamir.moreno

IDA

Interaction

RegulatedBy Rv2021c

yamir.moreno

IDA

Interaction

RegulatedBy Rv0757

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Interaction

RegulatedBy Rv0757

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006

Comments