TB Genome Annotation Portal

Rv2564 (glnQ)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ABC transporter ATP-binding protein
  • REFSEQ: glutamine-transport ATP-binding protein ABC transporter GlnQ
  • PATRIC: Glutamine-transport ATP-binding protein ABC transporter GlnQ
  • TUBERCULIST: Probable glutamine-transport ATP-binding protein ABC transporter GlnQ
  • NCBI: Probable glutamine-transport ATP-binding protein ABC transporter GlnQ
  • updated information (H37Rv4):
    • gene name: glnQ
    • function:
    • reference:
• Type: Not Target
• Start: 2883342
• End: 2884334
• Operon:


• Trans-membrane region:
  
• Role: III.A.1 - Amino acids
• GO terms:
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2YYZ	40%	Thermotoga maritima	Crystal structure of Sugar ABC transporter, ATP-binding protein
  4U02	40%	Thermus thermophilus HB8	Crystal structure of apo-TTHA1159
  4U00	40%	Thermus thermophilus HB8	Crystal structure of TTHA1159 in complex with ADP
  5X41	39%	Rhodobacter capsulatus	3.5A resolution structure of a cobalt energy-coupling factor transporter using LCP method-CbiMQO
  5X3X	39%	Rhodobacter capsulatus	2.8A resolution structure of a cobalt energy-coupling factor transporter-CbiMQO
  5NIL	39%	Escherichia coli (strain K12)	Structure of the MacAB-TolC ABC-type tripartite multidrug efflux pump-MacB section
  5NIK	39%	Escherichia coli (strain K12)	Structure of the MacAB-TolC ABC-type tripartite multidrug efflux pump
  5LJA	39%	Escherichia coli K-12	Structure of the E. coli MacB ABC domain (P6122)
  5LJ9	39%	Escherichia coli K-12	Structure of the E. coli MacB ABC domain (C2221)
  5X40	39%	Rhodobacter capsulatus	Structure of a CbiO dimer bound with AMPPCP

• Links to additional information on glnQ:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.434 (from Jeremy Rock's lab)

Amino Acid Sequence

MGGLTISDLVVEYSSGGYAVRPIDGLSLDVAPGSLVILLGPSGCGKTTLLSCLGGILRPKSGSIKFDDVDITTLEGAALAKYRRDKVGIVFQAFNLVSSL
TALENVMVPLRAAGVSRAAARKRAEDLLIRVNLGERMKHRPGDMSGGQQQRVAVARAIALDPQLILADEPTAHLDFIQVEEVLRLIRSLAQGDRVVVVAT
HDSRMLPLADRVLELMPAQVSPNQPPETVHVKAGEVLFEQSTMGDLIYVVSEGEFEIVRELADGGEELVKTAAPGDYFGEIGVLFHLPRSATVRARSDAT
AVGYTAQAFRERLGVTRVADLIEHRELASE

Additional Information