TB Genome Annotation Portal

Rv2563 (-)

Amino Acid Sequence

MLFAALRDVQWRKRRLVIAIVSTGLVFAMTLVLTGLVNGFRVEAERTVDSMGVDAFVVKAGAAGPFLGSTPFAQIDLPQVARAPGVLAAAPLATAPSTIR
QGTSARNVTAFGAPEHGPGMPRVSDGRAPSTPDEVAVSSTLGRNLGDDLQVGARTLRIVGIVPESTALAKIPNIFLTTEGLQQLAYNGQPTISSIGIDGM
PRQLPDGYQTVNRADAVSDLMRPLKVAVDAITVVAVLLWIVAALIVGSVVYLSALERLRDFAVFKAIGVPTRSILAGLALQAVVVALLAAVVGGILSLLL
APLFPMTVVVPLSAFVALPAIATVIGLLASVAGLRRVVAIDPALAFGGP
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2563/-, gene len: 1049 bp, num TA sites: 10
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.37)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.36)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.47)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.67 (0.66)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2563/-Rv1909c/furA-1.16
    Rv2563/-Rv0238/fdmR-1.31
    Rv2563/-Rv3286c/sigF-1.44
    Rv2563/-Rv0328/--1.47
    Rv2563/-Rv1358/--1.54


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2563 (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2564gaurisd10IDAStructural Analysis
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv2564gaurisd10IDAStructural Analysis
    authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv2564gaurisd10IDAStructural Analysis
    authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
    InteractionPhysicalInteraction Rv2564gaurisd10IDAStructural Analysis
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionPhysicalInteraction Rv2564gaurisd10IDASpectrophotometric
    authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
    InteractionPhysicalInteraction Rv2564gaurisd10IDASpectrophotometric
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv2564gaurisd10IDASpectrophotometric
    authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv0073gaurisd10IDAStructural Analysis
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv0411cgaurisd10IDAStructural Analysis
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv2564gaurisd10IDASpectrophotometric
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionPhysicalInteraction Rv0411cgaurisd10IDAStructural Analysis
    HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
    CitationThe ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. authors,M. Braibant,P. Gilot,J. Content FEMS Microbiol. Rev. 2000gaurisd10IDA10978546Structural Analysis
    InteractionPhysicalInteraction Rv2564gaurisd10IDAStructural Analysis
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    InteractionPhysicalInteraction Rv0072gaurisd10IDAStructural Analysis
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    InteractionPhysicalInteraction Rv0073gaurisd10IDAStructural Analysis
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    InteractionPhysicalInteraction Rv0411cgaurisd10IDAStructural Analysis
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    CitationLipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. authors,IC. Sutcliffe,DJ. Harrington FEMS Microbiol. Rev. 2004gaurisd10IDA15539077Structural Analysis
    InteractionPhysicalInteraction Rv2564gaurisd10IDAStructural Analysis
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv0072gaurisd10IDAStructural Analysis
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv0072gaurisd10IDAStructural Analysis
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionPhysicalInteraction Rv0073gaurisd10IDAStructural Analysis
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionPhysicalInteraction Rv0411cgaurisd10IDAStructural Analysis
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    CitationExtracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. HG. Wiker,MA. Wilson,GK. Schoolnik Microbiology (Reading, Engl.) 2000gaurisd10IDA10878117Structural Analysis
    InteractionPhysicalInteraction Rv2564gaurisd10IDAStructural Analysis
    HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
    InteractionPhysicalInteraction Rv0072gaurisd10IDAStructural Analysis
    HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
    InteractionPhysicalInteraction Rv0073gaurisd10IDAStructural Analysis
    HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
    InteractionPhysicalInteraction Rv0411cgaurisd10IDASpectrophotometric
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    CitationLipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. authors,IC. Sutcliffe,DJ. Harrington FEMS Microbiol. Rev. 2004gaurisd10IDA15539077Spectrophotometric
    InteractionPhysicalInteraction Rv2564gaurisd10IDASpectrophotometric
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv0072gaurisd10IDASpectrophotometric
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv0073gaurisd10IDASpectrophotometric
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    InteractionPhysicalInteraction Rv0411cgaurisd10IDASpectrophotometric
    authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
    CitationIdentification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall J. Proteome Res. nullgaurisd10IDA15952732Structural Analysis
    InteractionPhysicalInteraction Rv2564gaurisd10IDAStructural Analysis
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionPhysicalInteraction Rv0072gaurisd10IDASpectrophotometric
    HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
    InteractionPhysicalInteraction Rv0073gaurisd10IDASpectrophotometric
    HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
    InteractionPhysicalInteraction Rv0411cgaurisd10IDASpectrophotometric
    HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
    CitationThe ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. authors,M. Braibant,P. Gilot,J. Content FEMS Microbiol. Rev. 2000gaurisd10IDA10978546Spectrophotometric
    InteractionPhysicalInteraction Rv2564gaurisd10IDASpectrophotometric
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    InteractionPhysicalInteraction Rv0072gaurisd10IDASpectrophotometric
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    InteractionPhysicalInteraction Rv0073gaurisd10IDASpectrophotometric
    authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
    CitationIdentification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall J. Proteome Res. nullgaurisd10IDA15952732Spectrophotometric
    InteractionPhysicalInteraction Rv2564gaurisd10IDASpectrophotometric
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionPhysicalInteraction Rv0072gaurisd10IDASpectrophotometric
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionPhysicalInteraction Rv0073gaurisd10IDASpectrophotometric
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionPhysicalInteraction Rv0411cgaurisd10IDASpectrophotometric
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    CitationExtracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. HG. Wiker,MA. Wilson,GK. Schoolnik Microbiology (Reading, Engl.) 2000gaurisd10IDA10878117Spectrophotometric
    InteractionPhysicalInteraction Rv2564gaurisd10IDASpectrophotometric
    HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000

    Comments