TB Genome Annotation Portal

Rv2548 (vapC19)

Amino Acid Sequence

VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLARRYRSSHRGIDDVDYLIAATA
IVVDADLLTTNVRHFPMFPDLQPPY
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2548/vapC19, gene len: 377 bp, num TA sites: 5
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.15)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.265)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.59)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)0.8 (0.33)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2548/vapC19Rv0047c/napM-1.15
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2548 (vapC19)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv2547soumisenguptaISOGene Neighborhood (Functional linkage)
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    InteractionRegulatory Rv2547soumisenguptaISOGene Neighborhood (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    CitationThe PIN-domain toxin-antitoxin array in mycobacteria. authors,VL. Arcus,PB. Rainey,SJ. Turner Trends Microbiol. 2005soumisenguptaISO15993073Gene Neighborhood (Functional linkage)
    InteractionRegulatory Rv2547soumisenguptaISOGene Neighborhood (Functional linkage)
    authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009soumisenguptaISO20011113Gene Neighborhood (Functional linkage)
    InteractionRegulatory Rv2547soumisenguptaISOGene Neighborhood (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009jlew20011113VapC homolog, PIN domain, Toxic when expressed in Msmeg, rescued by antitoxin (Rv2547)
    SymbolVapC-mt19jlewExpression resulted in growth arrest in E coli. Expressed 23 VapC toxins in EC lacking TA modules. 4 inhibited growth.
    authors,JD. Sharp,JW. Cruz,S. Raman,M. Inouye,RN. Husson,NA. Woychik Growth and translation inhibition through sequence specific RNA binding by a mycobacterium tuberculosis VAPC toxin. The Journal of biological chemistry 2012
    CitationGrowth and translation inhibition through sequence specific RNA binding by a mycobacterium tuberculosis VAPC toxin. authors,JD. Sharp,JW. Cruz,S. Raman,M. Inouye,RN. Husson,NA. Woychik The Journal of biological chemistry 2012jlew22354968Expression resulted in growth arrest in E coli. Expressed 23 VapC toxins in EC lacking TA modules. 4 inhibited growth.
    SymbolVapCjlew
    authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
    CitationVapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi PLoS ONE 2011jlew21738782None
    SymbolVapC19jlewWe report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
    CitationKilling activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009jlew19016878We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    Otherstop:2869237rslaydenMTCY21B4.14c HYPOTHETICAL 15.0 KDA PROTEIN from Mycobacterium tuberculosis (133 aa), FASTA scores: opt: 265, E(): 7.1e-12, (42.3% identity in 123 aa overlap); Q97WY5
    Otherstrand:+rslaydenMTCY21B4.14c HYPOTHETICAL 15.0 KDA PROTEIN from Mycobacterium tuberculosis (133 aa), FASTA scores: opt: 265, E(): 7.1e-12, (42.3% identity in 123 aa overlap); Q97WY5
    Otherstart:2868860rslaydenSSO1975 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (125 aa), FASTA scores: opt: 131, E(): 0.018, (30.0% identity in 110 aa overlap); O52285
    Otherstop:2869237rslaydenSSO1975 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (125 aa), FASTA scores: opt: 131, E(): 0.018, (30.0% identity in 110 aa overlap); O52285
    Otherstrand:+rslaydenSSO1975 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (125 aa), FASTA scores: opt: 131, E(): 0.018, (30.0% identity in 110 aa overlap); O52285
    Otherstart:2868860rslaydenYLE HYPOTHETICAL 14.9 KDA PROTEIN from Agrobacterium radiobacter (133 aa), FASTA scores: opt: 128, E(): 0.03,(32.8% identity in 125 aa overlap); etc. TBscore is 0.865
    Otherstop:2869237rslaydenYLE HYPOTHETICAL 14.9 KDA PROTEIN from Agrobacterium radiobacter (133 aa), FASTA scores: opt: 128, E(): 0.03,(32.8% identity in 125 aa overlap); etc. TBscore is 0.865
    Otherstrand:+rslaydenYLE HYPOTHETICAL 14.9 KDA PROTEIN from Agrobacterium radiobacter (133 aa), FASTA scores: opt: 128, E(): 0.03,(32.8% identity in 125 aa overlap); etc. TBscore is 0.865
    Otherstart:2868860rslaydenConserved hypothetical protein. Some similarity to various proteins e.g. P71665
    Otherstop:2869237rslaydenConserved hypothetical protein. Some similarity to various proteins e.g. P71665
    Otherstrand:+rslaydenConserved hypothetical protein. Some similarity to various proteins e.g. P71665
    Otherstart:2868860rslaydenRv1397c
    Otherstop:2869237rslaydenRv1397c
    Otherstrand:+rslaydenRv1397c
    Otherstart:2868860rslaydenMTCY21B4.14c HYPOTHETICAL 15.0 KDA PROTEIN from Mycobacterium tuberculosis (133 aa), FASTA scores: opt: 265, E(): 7.1e-12, (42.3% identity in 123 aa overlap); Q97WY5

    Comments