TB Genome Annotation Portal

Rv2524c (fas)

Amino Acid Sequence

VTIHEHDRVSADRGGDSPHTTHALVDRLMAGEPYAVAFGGQGSAWLETLEELVSATGIETELATLVGEAELLLDPVTDELIVVRPIGFEPLQWVRALAAE
DPVPSDKHLTSAAVSVPGVLLTQIAATRALARQGMDLVATPPVAMAGHSQGVLAVEALKAGGARDVELFALAQLIGAAGTLVARRRGISVLGDRPPMVSV
TNADPERIGRLLDEFAQDVRTVLPPVLSIRNGRRAVVITGTPEQLSRFELYCRQISEKEEADRKNKVRGGDVFSPVFEPVQVEVGFHTPRLSDGIDIVAG
WAEKAGLDVALARELADAILIRKVDWVDEITRVHAAGARWILDLGPGDILTRLTAPVIRGLGIGIVPAATRGGQRNLFTVGATPEVARAWSSYAPTVVRL
PDGRVKLSTKFTRLTGRSPILLAGMTPTTVDAKIVAAAANAGHWAELAGGGQVTEEIFGNRIEQMAGLLEPGRTYQFNALFLDPYLWKLQVGGKRLVQKA
RQSGAAIDGVVISAGIPDLDEAVELIDELGDIGISHVVFKPGTIEQIRSVIRIATEVPTKPVIMHVEGGRAGGHHSWEDLDDLLLATYSELRSRANITVC
VGGGIGTPRRAAEYLSGRWAQAYGFPLMPIDGILVGTAAMATKESTTSPSVKRMLVDTQGTDQWISAGKAQGGMASSRSQLGADIHEIDNSASRCGRLLD
EVAGDAEAVAERRDEIIAAMAKTAKPYFGDVADMTYLQWLRRYVELAIGEGNSTADTASVGSPWLADTWRDRFEQMLQRAEARLHPQDFGPIQTLFTDAG
LLDNPQQAIAALLARYPDAETVQLHPADVPFFVTLCKTLGKPVNFVPVIDQDVRRWWRSDSLWQAHDARYDADAVCIIPGTASVAGITRMDEPVGELLDR
FEQAAIDEVLGAGVEPKDVASRRLGRADVAGPLAVVLDAPDVRWAGRTVTNPVHRIADPAEWQVHDGPENPRATHSSTGARLQTHGDDVALSVPVSGTWV
DIRFTLPANTVDGGTPVIATEDATSAMRTVLAIAAGVDSPEFLPAVANGTATLTVDWHPERVADHTGVTATFGEPLAPSLTNVPDALVGPCWPAVFAAIG
SAVTDTGEPVVEGLLSLVHLDHAARVVGQLPTVPAQLTVTATAANATDTDMGRVVPVSVVVTGADGAVIATLEERFAILGRTGSAELADPARAGGAVSAN
ATDTPRRRRRDVTITAPVDMRPFAVVSGDHNPIHTDRAAALLAGLESPIVHGMWLSAAAQHAVTATDGQARPPARLVGWTARFLGMVRPGDEVDFRVERV
GIDQGAEIVDVAARVGSDLVMSASARLAAPKTVYAFPGQGIQHKGMGMEVRARSKAARKVWDTADKFTRDTLGFSVLHVVRDNPTSIIASGVHYHHPDGV
LYLTQFTQVAMATVAAAQVAEMREQGAFVEGAIACGHSVGEYTALACVTGIYQLEALLEMVFHRGSKMHDIVPRDELGRSNYRLAAIRPSQIDLDDADVP
AFVAGIAESTGEFLEIVNFNLRGSQYAIAGTVRGLEALEAEVERRRELTGGRRSFILVPGIDVPFHSRVLRVGVAEFRRSLDRVMPRDADPDLIIGRYIP
NLVPRLFTLDRDFIQEIRDLVPAEPLDEILADYDTWLRERPREMARTVFIELLAWQFASPVRWIETQDLLFIEEAAGGLGVERFVEIGVKSSPTVAGLAT
NTLKLPEYAHSTVEVLNAERDAAVLFATDTDPEPEPEEDEPVAESPAPDVVSEAAPVAPAASSAGPRPDDLVFDAADATLALIALSAKMRIDQIEELDSI
ESITDGASSRRNQLLVDLGSELNLGAIDGAAESDLAGLRSQVTKLARTYKPYGPVLSDAINDQLRTVLGPSGKRPGAIAERVKKTWELGEGWAKHVTVEV
ALGTREGSSVRGGAMGHLHEGALADAASVDKVIDAAVASVAARQGVSVALPSAGSGGGATIDAAALSEFTDQITGREGVLASAARLVLGQLGLDDPVNAL
PAAPDSELIDLVTAELGADWPRLVAPVFDPKKAVVFDDRWASAREDLVKLWLTDEGDIDADWPRLAERFEGAGHVVATQATWWQGKSLAAGRQIHASLYG
RIAAGAENPEPGRYGGEVAVVTGASKGSIAASVVARLLDGGATVIATTSKLDEERLAFYRTLYRDHARYGAALWLVAANMASYSDVDALVEWIGTEQTES
LGPQSIHIKDAQTPTLLFPFAAPRVVGDLSEAGSRAEMEMKVLLWAVQRLIGGLSTIGAERDIASRLHVVLPGSPNRGMFGGDGAYGEAKSALDAVVSRW
HAESSWAARVSLAHALIGWTRGTGLMGHNDAIVAAVEEAGVTTYSTDEMAALLLDLCDAESKVAAARSPIKADLTGGLAEANLDMAELAAKAREQMSAAA
AVDEDAEAPGAIAALPSPPRGFTPAPPPQWDDLDVDPADLVVIVGGAEIGPYGSSRTRFEMEVENELSAAGVLELAWTTGLIRWEDDPQPGWYDTESGEM
VDESELVQRYHDAVVQRVGIREFVDDGAIDPDHASPLLVSVFLEKDFAFVVSSEADARAFVEFDPEHTVIRPVPDSTDWQVIRKAGTEIRVPRKTKLSRV
VGGQIPTGFDPTVWGISADMAGSIDRLAVWNMVATVDAFLSSGFSPAEVMRYVHPSLVANTQGTGMGGGTSMQTMYHGNLLGRNKPNDIFQEVLPNIIAA
HVVQSYVGSYGAMIHPVAACATAAVSVEEGVDKIRLGKAQLVVAGGLDDLTLEGIIGFGDMAATADTSMMCGRGIHDSKFSRPNDRRRLGFVEAQGGGTI
LLARGDLALRMGLPVLAVVAFAQSFGDGVHTSIPAPGLGALGAGRGGKDSPLARALAKLGVAADDVAVISKHDTSTLANDPNETELHERLADALGRSEGA
PLFVVSQKSLTGHAKGGAAVFQMMGLCQILRDGVIPPNRSLDCVDDELAGSAHFVWVRDTLRLGGKFPLKAGMLTSLGFGHVSGLVALVHPQAFIASLDP
AQRADYQRRADARLLAGQRRLASAIAGGAPMYQRPGDRRFDHHAPERPQEASMLLNPAARLGDGEAYIG
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.12 (0.51)2.22 (0.89)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
69 non-insertions in a row out of 71 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
69 non-insertions in a row out of 71 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
69 non-insertions in a row out of 71 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
71 non-insertions in a row out of 71 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
69 non-insertions in a row out of 71 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.02
Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2524c (fas)

    PropertyValueCreatorEvidencePMIDComment
    CitationIdentification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. KH. Choi, L. Kremer et al. J. Biol. Chem. 2000njamshidiIDA10840036mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II).
    TermEC:2.3.1.85 Fatty-acid synthase. - IDAnjamshidiIDA10840036mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II).
    KH. Choi, L. Kremer et al. Identification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. J. Biol. Chem. 2000
    TermTBRXN:FAS140 fatty acid synthase (n-C14:0) - IDAnjamshidiIDA10840036mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II).
    KH. Choi, L. Kremer et al. Identification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. J. Biol. Chem. 2000
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
    InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    InteractionRegulatedBy Rv1221yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    NameFatty acid synthetase type ImjacksonIMPFAS-I
    NameFatty acid synthetase type ImjacksonIDAFAS-I
    TermEC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NRjjmcfaddenNRInferred from direct assay
    ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
    TermEC:1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase. - NRjjmcfaddenNRInferred from direct assay
    ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
    TermEC:1.3.1.10 Enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific). - NRjjmcfaddenNRInferred from direct assay
    ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
    CitationCloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. ND. Fernandes & PE. Kolattukudy Gene 1996jjmcfadden8621098Inferred from direct assay
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRjjmcfaddenNRInferred from direct assay
    ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
    TermEC:1.3.1.11 2-coumarate reductase. - NRjjmcfaddenNRInferred from direct assay
    ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
    TermEC:1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    TermEC:1.3.1.9 Enoyl-[acyl-carrier-protein] reductase (NADH). - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    TermEC:4.2.1.58 Crotonoyl-[acyl-carrier-protein] hydratase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    TermEC:4.2.1.59 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    TermEC:4.2.1.61 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    TermEC:4.2.1.- Lyases. Carbon-oxygen lyases. Hydro-lyases. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    TermEC:2.3.1.86 Fatty-acyl-CoA synthase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    CitationPurification and properties of the fatty acid synthetase from Mycobacterium phlei. authors,DE. Vance,O. Mitsuhashi,K. Bloch J. Biol. Chem. 1973extern:JZUCKER4698221Assay of protein purified to homogeneity from a heterlogous host
    TermEC:2.3.1.38 [Acyl-carrier-protein] S-acetyltransferase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
    TermEC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from a heterlogous host
    authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973

    Comments