Rv2524c (fas)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: fatty acid synthase
- REFSEQ: fatty acid synthase
- PATRIC: [Acyl-carrier-protein] acetyl transferase of FASI (EC 2.3.1.38) / Enoyl-[acyl-carrier-protein] reductase of FASI (EC 1.3.1.9) / 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase of FASI (EC 4.2.1.61) / [Acyl-carrier-protein] malonyl transferase of FASI (EC 2.3.1.39) / [Acyl-carrier-protein] palmitoyl transferase of FASI (EC 2.3.1.-) / Acyl carrier protein of FASI / 3-oxoacyl-[acyl-carrier-protein] reductase of FASI (EC 1.1.1.100) / 3-oxoacyl-[acyl-carrier-protein] synthase of FASI (EC 2.3.1.41)
- TUBERCULIST: Probable fatty acid synthase Fas (fatty acid synthetase)
- NCBI: Probable fatty acid synthase Fas (fatty acid synthetase)
- updated information (H37Rv4):
  - gene name: fas
  - function:
  - reference:
Type: Not Target
Start: 2840123
End: 2849332
Operon:

Trans-membrane region:
Role: I.H.1 - Synthesis of fatty and mycolic acids
GO terms:
- GO:0055114 - oxidation-reduction process (Uniprot)
- GO:0042802 - identical protein binding (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
- GO:0006633 - fatty acid biosynthetic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005835 - fatty acid synthase complex (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0004318 - enoyl-[acyl-carrier-protein] reductase (NADH) activity (Uniprot)
- GO:0004314 - [acyl-carrier-protein] S-malonyltransferase activity (Uniprot)
- GO:0004312 - fatty acid synthase activity (Uniprot)
- GO:0003824 - catalytic activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6GJC	100%	Mycobacterium tuberculosis	Structure of Mycobacterium tuberculosis Fatty Acid Synthase - I
4V8W	81%	MYCOBACTERIUM TUBERCULOSIS	Structure and conformational variability of the Mycobacterium tuberculosis fatty acid synthase multienzyme complex
4V8V	81%	MYCOBACTERIUM TUBERCULOSIS	Structure and conformational variability of the Mycobacterium tuberculosis fatty acid synthase multienzyme complex
4V8L	77%	MYCOBACTERIUM SMEGMATIS	Cryo-EM Structure of the Mycobacterial Fatty Acid Synthase
5CPG	40%	Pseudomonas aeruginosa	R-Hydratase PhaJ1 from Pseudomonas aeruginosa in the unliganded form
6JSI	35%	Saccharomyces cerevisiae	Co-purified Fatty Acid Synthase
6JSH	35%	Saccharomyces cerevisiae	Apo-state Fatty Acid Synthase

Links to additional information on fas:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -8.972 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VTIHEHDRVSADRGGDSPHTTHALVDRLMAGEPYAVAFGGQGSAWLETLEELVSATGIETELATLVGEAELLLDPVTDELIVVRPIGFEPLQWVRALAAE
DPVPSDKHLTSAAVSVPGVLLTQIAATRALARQGMDLVATPPVAMAGHSQGVLAVEALKAGGARDVELFALAQLIGAAGTLVARRRGISVLGDRPPMVSV
TNADPERIGRLLDEFAQDVRTVLPPVLSIRNGRRAVVITGTPEQLSRFELYCRQISEKEEADRKNKVRGGDVFSPVFEPVQVEVGFHTPRLSDGIDIVAG
WAEKAGLDVALARELADAILIRKVDWVDEITRVHAAGARWILDLGPGDILTRLTAPVIRGLGIGIVPAATRGGQRNLFTVGATPEVARAWSSYAPTVVRL
PDGRVKLSTKFTRLTGRSPILLAGMTPTTVDAKIVAAAANAGHWAELAGGGQVTEEIFGNRIEQMAGLLEPGRTYQFNALFLDPYLWKLQVGGKRLVQKA
RQSGAAIDGVVISAGIPDLDEAVELIDELGDIGISHVVFKPGTIEQIRSVIRIATEVPTKPVIMHVEGGRAGGHHSWEDLDDLLLATYSELRSRANITVC
VGGGIGTPRRAAEYLSGRWAQAYGFPLMPIDGILVGTAAMATKESTTSPSVKRMLVDTQGTDQWISAGKAQGGMASSRSQLGADIHEIDNSASRCGRLLD
EVAGDAEAVAERRDEIIAAMAKTAKPYFGDVADMTYLQWLRRYVELAIGEGNSTADTASVGSPWLADTWRDRFEQMLQRAEARLHPQDFGPIQTLFTDAG
LLDNPQQAIAALLARYPDAETVQLHPADVPFFVTLCKTLGKPVNFVPVIDQDVRRWWRSDSLWQAHDARYDADAVCIIPGTASVAGITRMDEPVGELLDR
FEQAAIDEVLGAGVEPKDVASRRLGRADVAGPLAVVLDAPDVRWAGRTVTNPVHRIADPAEWQVHDGPENPRATHSSTGARLQTHGDDVALSVPVSGTWV
DIRFTLPANTVDGGTPVIATEDATSAMRTVLAIAAGVDSPEFLPAVANGTATLTVDWHPERVADHTGVTATFGEPLAPSLTNVPDALVGPCWPAVFAAIG
SAVTDTGEPVVEGLLSLVHLDHAARVVGQLPTVPAQLTVTATAANATDTDMGRVVPVSVVVTGADGAVIATLEERFAILGRTGSAELADPARAGGAVSAN
ATDTPRRRRRDVTITAPVDMRPFAVVSGDHNPIHTDRAAALLAGLESPIVHGMWLSAAAQHAVTATDGQARPPARLVGWTARFLGMVRPGDEVDFRVERV
GIDQGAEIVDVAARVGSDLVMSASARLAAPKTVYAFPGQGIQHKGMGMEVRARSKAARKVWDTADKFTRDTLGFSVLHVVRDNPTSIIASGVHYHHPDGV
LYLTQFTQVAMATVAAAQVAEMREQGAFVEGAIACGHSVGEYTALACVTGIYQLEALLEMVFHRGSKMHDIVPRDELGRSNYRLAAIRPSQIDLDDADVP
AFVAGIAESTGEFLEIVNFNLRGSQYAIAGTVRGLEALEAEVERRRELTGGRRSFILVPGIDVPFHSRVLRVGVAEFRRSLDRVMPRDADPDLIIGRYIP
NLVPRLFTLDRDFIQEIRDLVPAEPLDEILADYDTWLRERPREMARTVFIELLAWQFASPVRWIETQDLLFIEEAAGGLGVERFVEIGVKSSPTVAGLAT
NTLKLPEYAHSTVEVLNAERDAAVLFATDTDPEPEPEEDEPVAESPAPDVVSEAAPVAPAASSAGPRPDDLVFDAADATLALIALSAKMRIDQIEELDSI
ESITDGASSRRNQLLVDLGSELNLGAIDGAAESDLAGLRSQVTKLARTYKPYGPVLSDAINDQLRTVLGPSGKRPGAIAERVKKTWELGEGWAKHVTVEV
ALGTREGSSVRGGAMGHLHEGALADAASVDKVIDAAVASVAARQGVSVALPSAGSGGGATIDAAALSEFTDQITGREGVLASAARLVLGQLGLDDPVNAL
PAAPDSELIDLVTAELGADWPRLVAPVFDPKKAVVFDDRWASAREDLVKLWLTDEGDIDADWPRLAERFEGAGHVVATQATWWQGKSLAAGRQIHASLYG
RIAAGAENPEPGRYGGEVAVVTGASKGSIAASVVARLLDGGATVIATTSKLDEERLAFYRTLYRDHARYGAALWLVAANMASYSDVDALVEWIGTEQTES
LGPQSIHIKDAQTPTLLFPFAAPRVVGDLSEAGSRAEMEMKVLLWAVQRLIGGLSTIGAERDIASRLHVVLPGSPNRGMFGGDGAYGEAKSALDAVVSRW
HAESSWAARVSLAHALIGWTRGTGLMGHNDAIVAAVEEAGVTTYSTDEMAALLLDLCDAESKVAAARSPIKADLTGGLAEANLDMAELAAKAREQMSAAA
AVDEDAEAPGAIAALPSPPRGFTPAPPPQWDDLDVDPADLVVIVGGAEIGPYGSSRTRFEMEVENELSAAGVLELAWTTGLIRWEDDPQPGWYDTESGEM
VDESELVQRYHDAVVQRVGIREFVDDGAIDPDHASPLLVSVFLEKDFAFVVSSEADARAFVEFDPEHTVIRPVPDSTDWQVIRKAGTEIRVPRKTKLSRV
VGGQIPTGFDPTVWGISADMAGSIDRLAVWNMVATVDAFLSSGFSPAEVMRYVHPSLVANTQGTGMGGGTSMQTMYHGNLLGRNKPNDIFQEVLPNIIAA
HVVQSYVGSYGAMIHPVAACATAAVSVEEGVDKIRLGKAQLVVAGGLDDLTLEGIIGFGDMAATADTSMMCGRGIHDSKFSRPNDRRRLGFVEAQGGGTI
LLARGDLALRMGLPVLAVVAFAQSFGDGVHTSIPAPGLGALGAGRGGKDSPLARALAKLGVAADDVAVISKHDTSTLANDPNETELHERLADALGRSEGA
PLFVVSQKSLTGHAKGGAAVFQMMGLCQILRDGVIPPNRSLDCVDDELAGSAHFVWVRDTLRLGGKFPLKAGMLTSLGFGHVSGLVALVHPQAFIASLDP
AQRADYQRRADARLLAGQRRLASAIAGGAPMYQRPGDRRFDHHAPERPQEASMLLNPAARLGDGEAYIG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 69 non-insertions in a row out of 71 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 69 non-insertions in a row out of 71 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 69 non-insertions in a row out of 71 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 71 non-insertions in a row out of 71 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 69 non-insertions in a row out of 71 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.02
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0135c (-) (Direct binding)
- Rv0302 (-) (Direct binding)
- Rv1033c (trcR) (Direct binding)
- Rv3249c (-) (Direct binding)
- Rv3736 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Citation	Identification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. KH. Choi, L. Kremer et al. J. Biol. Chem. 2000	njamshidi	IDA	10840036	mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II).
Term	EC:2.3.1.85 Fatty-acid synthase. - IDA	njamshidi	IDA	10840036	mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II). KH. Choi, L. Kremer et al. Identification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	TBRXN:FAS140 fatty acid synthase (n-C14:0) - IDA	njamshidi	IDA	10840036	mtFABH (Rv0533c) - link between FAS I and FAS II - highest affinity for C12:0, see PMID: 10840036 (since FA synthesis is lumped, does not extend immediately to FAS II). KH. Choi, L. Kremer et al. Identification and substrate specificity of beta -ketoacyl (acyl carrier protein) synthase III (mtFabH) from Mycobacterium tuberculosis. J. Biol. Chem. 2000
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv3911	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv1221	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Name	Fatty acid synthetase type I	mjackson	IMP		FAS-I
Name	Fatty acid synthetase type I	mjackson	IDA		FAS-I
Term	EC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NR	jjmcfadden	NR		Inferred from direct assay ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
Term	EC:1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase. - NR	jjmcfadden	NR		Inferred from direct assay ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
Term	EC:1.3.1.10 Enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific). - NR	jjmcfadden	NR		Inferred from direct assay ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
Citation	Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. ND. Fernandes & PE. Kolattukudy Gene 1996	jjmcfadden		8621098	Inferred from direct assay
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	jjmcfadden	NR		Inferred from direct assay ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
Term	EC:1.3.1.11 2-coumarate reductase. - NR	jjmcfadden	NR		Inferred from direct assay ND. Fernandes & PE. Kolattukudy Cloning, sequencing and characterization of a fatty acid synthase-encoding gene from Mycobacterium tuberculosis var. bovis BCG. Gene 1996
Term	EC:1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Term	EC:1.3.1.9 Enoyl-[acyl-carrier-protein] reductase (NADH). - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Term	EC:4.2.1.58 Crotonoyl-[acyl-carrier-protein] hydratase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Term	EC:4.2.1.59 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Term	EC:4.2.1.61 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Term	EC:4.2.1.- Lyases. Carbon-oxygen lyases. Hydro-lyases. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Term	EC:2.3.1.86 Fatty-acyl-CoA synthase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Citation	Purification and properties of the fatty acid synthetase from Mycobacterium phlei. authors,DE. Vance,O. Mitsuhashi,K. Bloch J. Biol. Chem. 1973	extern:JZUCKER		4698221	Assay of protein purified to homogeneity from a heterlogous host
Term	EC:2.3.1.38 [Acyl-carrier-protein] S-acetyltransferase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973
Term	EC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host authors,DE. Vance,O. Mitsuhashi,K. Bloch Purification and properties of the fatty acid synthetase from Mycobacterium phlei. J. Biol. Chem. 1973

TB Genome Annotation Portal