Rv2497c (bkdA)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: pyruvate dehydrogenase (acetyl-transferring) E1 component alpha subunit
REFSEQ: pyruvate dehydrogenase E1 component alpha subunit PdhA
PATRIC: Branched-chain alpha-keto acid dehydrogenase E1 component alpha subunit (EC 1.2.4.4)
TUBERCULIST: Probable branched-chain keto acid dehydrogenase E1 component alpha subunit BkdA
NCBI: Probable branched-chain keto acid dehydrogenase E1 component, alpha subunit BkdA
updated information (H37Rv4):
gene name: bkdA
function:
reference:
Coordinates in H37Rv: 2810993 - 2812096
Gene length: 1104 bp (with stop codon), 367 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.B.2 - Pyruvate dehydrogenase
GO terms:
GO:0055114 - oxidation-reduction process (Uniprot)
GO:0046872 - metal ion binding (Uniprot)
GO:0016624 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor (Uniprot)
GO:0016491 - oxidoreductase activity (Uniprot)
GO:0008152 - metabolic process (Uniprot)
GO:0005515 - protein binding (Uniprot)
GO:0003863 - 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 1UMD 40% Thermus thermophilus branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 with 4-methyl-2-oxopentanoate as an intermediate 1UMC 40% Thermus thermophilus branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 with 4-methylpentanoate 1UMB 40% Thermus thermophilus branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 in holo-form 1UM9 40% Thermus thermophilus branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 in apo-form 3DV0 39% Bacillus stearothermophilus Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex 3DUF 39% Bacillus stearothermophilus Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex 1W85 39% GEOBACILLUS STEAROTHERMOPHILUS The crystal structure of pyruvate dehydrogenase E1 bound to the peripheral subunit binding domain of E2 2BFF 38% HOMO SAPIENS Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch 2BEW 38% HOMO SAPIENS Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch 2BEV 38% HOMO SAPIENS Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Links to additional information on bkdA:
Amino Acid Sequence
MGEGSRRPSGMLMSVDLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTPCRGQEAAQVGAAACLRKTDWLFPQY
RELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVFYVQNN
QWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYL
QDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLRAELARTD
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv2497c/bkdA,
gene len: 1103 bp, num TA sites: 23
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=1.87) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=-0.066) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-0.11) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv2497c: 0.650574495
lineage-specific pN/pS in L1: 0.478051777
lineage-specific pN/pS in L2: 1.027064365
lineage-specific pN/pS in L3: 0.462401273
lineage-specific pN/pS in L4: 0.686717523
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.4 (0.39)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Citation Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005 akankshajain.21 IEP 16045627 Coexpression
Interaction Operon Rv2495c akankshajain.21 IEP CoexpressionJ. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Interaction Operon Rv2496c akankshajain.21 IEP CoexpressionJ. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Interaction Operon Rv2495c akankshajain.21 IEP CoexpressionJ. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Interaction Operon Rv2496c akankshajain.21 IEP CoexpressionJ. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Interaction RegulatedBy Rv0348 yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction RegulatedBy Rv0182c yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Citation Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Trends Microbiol. 2011 extern:JZUCKER 21561773 Traceable author statement to experimental support
Term EC:1.2.4.1 Pyruvate dehydrogenase (acetyl-transferring). - NR extern:JZUCKER NR Traceable author statement to experimental supportauthors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term EC:1.2.4.4 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). - NR extern:JZUCKER NR Traceable author statement to experimental supportauthors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Citation Virulence of Mycobacterium tuberculosis depends on lipoamide dehydrogenase, a member of three multienzyme complexes. authors,A. Venugopal,R. Bryk,S. Shi,K. Rhee,P. Rath,D. Schnappinger,S. Ehrt,C. Nathan Cell Host Microbe 2011 extern:JZUCKER 21238944 Inferred from mutant phenotype
Term EC:1.2.4.1 Pyruvate dehydrogenase (acetyl-transferring). - NR extern:JZUCKER NR Inferred from mutant phenotypeauthors,A. Venugopal,R. Bryk,S. Shi,K. Rhee,P. Rath,D. Schnappinger,S. Ehrt,C. Nathan Virulence of Mycobacterium tuberculosis depends on lipoamide dehydrogenase, a member of three multienzyme complexes. Cell Host Microbe 2011
Term EC:1.2.4.4 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring). - NR extern:JZUCKER NR Inferred from mutant phenotypeauthors,A. Venugopal,R. Bryk,S. Shi,K. Rhee,P. Rath,D. Schnappinger,S. Ehrt,C. Nathan Virulence of Mycobacterium tuberculosis depends on lipoamide dehydrogenase, a member of three multienzyme complexes. Cell Host Microbe 2011