TB Genome Annotation Portal

Rv2465c (rpiB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ribose-5-phosphate isomerase B
  • REFSEQ: ribose-5-phosphate isomerase B
  • PATRIC: Ribose 5-phosphate isomerase B (EC 5.3.1.6) / Galactose 6-phosphate isomerase
  • TUBERCULIST: Ribose-5-phosphate isomerase
  • NCBI: Ribose-5-phosphate isomerase
  • updated information (H37Rv4):
    • gene name: rpiB
    • function:
    • reference:
• Type: Not Target
• Start: 2767671
• End: 2768159
• Operon:


• Trans-membrane region:
  
• Role: I.B.5 - Pentose phosphate pathway
• GO terms:
  • GO:0016853 - isomerase activity (Uniprot)
  • GO:0009052 - pentose-phosphate shunt, non-oxidative branch (Uniprot)
  • GO:0006098 - pentose-phosphate shunt (Uniprot)
  • GO:0005975 - carbohydrate metabolic process (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004751 - ribose-5-phosphate isomerase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • RL5P[c] <=> R5P[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2bes, 2bet, 2vvq, 2vvp, 1usl, 2vvo
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2VVQ	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis ribose-5-phosphate isomerase B in complex with the inhibitor 5-deoxy-5-phospho-D- ribonate
  2VVP	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis ribose-5-phosphate isomerase B in complex with its substrates ribose 5-phosphate and ribulose 5-phosphate
  2VVO	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis ribose-5-phosphate isomerase B in complex with alpha d-allose 6-phosphate
  2BET	100%	MYCOBACTERIUM TUBERCULOSIS	Structure of Mycobacterium tuberculosis Ribose-5-Phosphate Isomerase, RpiB, Rv2465c, in complex with 4-phospho-D-erythronate.
  2BES	100%	MYCOBACTERIUM TUBERCULOSIS	Structure of Mycobacterium tuberculosis Ribose-5-Phosphate Isomerase, RpiB, Rv2465c, in complex with 4-phospho-D-erythronohydroxamic acid.
  1USL	100%	MYCOBACTERIUM TUBERCULOSIS	Structure Of Mycobacterium tuberculosis Ribose-5-Phosphate Isomerase, RpiB, Rv2465c, Complexed With Phosphate.
  6MU0	42%	Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)	Crystal Structure of Ribose-5-phosphate Isomerase B from Mycoplasma genitalium with bound Ribulose-5-phosphate
  3PH4	38%	Clostridium thermocellum	Clostridium thermocellum Ribose-5-Phosphate Isomerase B with d-allose
  3PH3	38%	Clostridium thermocellum	Clostridium thermocellum Ribose-5-Phosphate Isomerase B with d-ribose
  3HEE	37%	Clostridium thermocellum	Structural study of Clostridium thermocellum Ribose-5-Phosphate Isomerase B and ribose-5-phosphate

• Links to additional information on rpiB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -4.875 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSGMRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAR
EHNNAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAQRHQRRIDILAEYERTHEAPPVPGAPA

Additional Information