TB Genome Annotation Portal

Rv2460c (clpP2)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ATP-dependent Clp protease proteolytic subunit 2
  • REFSEQ: ATP-dependent Clp protease proteolytic subunit
  • PATRIC: ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)
  • TUBERCULIST: Probable ATP-dependent CLP protease proteolytic subunit 2 ClpP2 (endopeptidase CLP 2)
  • NCBI: Probable ATP-dependent CLP protease proteolytic subunit 2 ClpP2 (endopeptidase CLP 2)
  • updated information (H37Rv4):
    • gene name: clpP2
    • function:
    • reference:
• Type: Not Target
• Start: 2762531
• End: 2763175
• Operon:


• Trans-membrane region:
  
• Role: II.B.3 - Proteins, peptides and glycopeptides
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0008236 - serine-type peptidase activity (Uniprot)
  • GO:0008233 - peptidase activity (Uniprot)
  • GO:0006508 - proteolysis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004252 - serine-type endopeptidase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6VGQ	100%	Mycobacterium tuberculosis	ClpP1P2 complex from M. tuberculosis with GLF-CMK bound to ClpP1
  6VGN	100%	Mycobacterium tuberculosis	ClpP1P2 complex from M. tuberculosis bound to ADEP
  6VGK	100%	Mycobacterium tuberculosis	ClpP1P2 complex from M. tuberculosis
  6IW7	100%	Mycobacterium tuberculosis CDC1551	structural insights into Mycobacterium tuberculosis ClpP1P2 inhibition by Cediranib: implications for developing antimicrobial agents targeting Clp protease
  4U0G	100%	Mycobacterium tuberculosis	Crystal Structure of M. tuberculosis ClpP1P2 bound to ADEP and agonist
  5E0S	99%	Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)	crystal structure of the active form of the proteolytic complex clpP1 and clpP2
  5DZK	99%	Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)	Crystal structure of the active form of the proteolytic complex clpP1 and clpP2
  6L40	52%	Staphylococcus aureus (strain bovine RF122 / ET3-1)	Discovery of novel peptidomimetic boronate ClpP inhibitors with noncanonical enzyme mechanism as potent virulence blockers in vitro and in vivo
  6L3X	52%	Staphylococcus aureus RF122	Discovery of novel peptidomimetic boronate ClpP inhibitors with noncanonical enzyme mechanism as potent virulence blockers in vitro and in vivo
  6CFD	51%	Enterococcus faecium	ADEP4 bound to E. faecium ClpP

• Links to additional information on clpP2:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -10.58 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VNSQNSQIQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADI
QTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGII
DTVLEYRKLSAQTA

Additional Information