TB Genome Annotation Portal

Rv2399c (cysT)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: sulfate ABC transporter permease CysT
  • REFSEQ: sulfate-transport integral membrane protein ABC transporter CysT
  • PATRIC: Sulfate transport system permease protein CysT
  • TUBERCULIST: Probable sulfate-transport integral membrane protein ABC transporter CysT
  • NCBI: Probable sulfate-transport integral membrane protein ABC transporter CysT
  • updated information (H37Rv4):
    • gene name: cysT
    • function:
    • reference:
• Type: Not Target
• Start: 2695796
• End: 2696647
• Operon:


• Trans-membrane region:
  
• Role: III.A.4 - Anions
• GO terms:
  • GO:1902358 - sulfate transmembrane transport (Uniprot)
  • GO:0099133 - ATP hydrolysis coupled anion transmembrane transport (Uniprot)
  • GO:0055085 - transmembrane transport (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0015419 - ATPase-coupled sulfate transmembrane transporter activity (Uniprot)
  • GO:0015116 - sulfate transmembrane transporter activity (Uniprot)
  • GO:0008272 - sulfate transport (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0000103 - sulfate assimilation (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] -> ADP[c] + PI[c] + SLF[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on cysT:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.07 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTESLVGERRAPQFRARLSGPAGPPSVRVGMAVVWLSVIVLLPLAAIVWQAAGGGWRAFWLAVSSHAAMESFRVTLTISTAVTVINLVFGLLIAWVLVRD
DFAGKRIVDAIIDLPFALPTIVASLVMLALYGNNSPVGLHFQHTATGVGVALAFVTLPFVVRAVQPVLLEIDRETEEAAASLGANGAKIFTSVVLPSLTP
ALLSGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWIRTLIENDDRTGAAAISVVLLSISFIVLLILRVVGARAAKREEMAA

Additional Information