TB Genome Annotation Portal

Rv2397c (cysA1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: sulfate/thiosulfate import ATP-binding protein CysA
  • REFSEQ: sulfate-transport ATP-binding protein ABC transporter CysA1
  • PATRIC: Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)
  • TUBERCULIST: Sulfate-transport ATP-binding protein ABC transporter CysA1
  • NCBI: Sulfate-transport ATP-binding protein ABC transporter CysA1
  • updated information (H37Rv4):
    • gene name: cysA1
    • function: part of transporter (cysA1TW)
    • reference:
• Type: Not Target
• Start: 2693909
• End: 2694964
• Operon:


• Trans-membrane region:
  
• Role: III.A.4 - Anions
• GO terms:
  • GO:1902358 - sulfate transmembrane transport (Uniprot)
  • GO:0102025 - ATPase-coupled thiosulfate transmembrane transporter activity (Uniprot)
  • GO:0099133 - ATP hydrolysis coupled anion transmembrane transport (Uniprot)
  • GO:0043190 - ATP-binding cassette (ABC) transporter complex (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0015709 - thiosulfate transport (Uniprot)
  • GO:0015419 - ATPase-coupled sulfate transmembrane transporter activity (Uniprot)
  • GO:0008272 - sulfate transport (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0000103 - sulfate assimilation (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] -> ADP[c] + PI[c] + SLF[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1Z47	55%	Alicyclobacillus acidocaldarius	Structure of the ATPase subunit CysA of the putative sulfate ATP-binding cassette (ABC) transporter from Alicyclobacillus acidocaldarius
  2IT1	52%	Pyrococcus horikoshii	Structure of PH0203 protein from Pyrococcus horikoshii
  1VCI	50%	Pyrococcus horikoshii	Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3 complexed with ATP
  1V43	50%	Pyrococcus horikoshii	Crystal Structure of ATPase subunit of ABC Sugar Transporter
  1G29	48%	Thermococcus litoralis	MALK
  2D62	47%	Pyrococcus horikoshii	Crystal structure of multiple sugar binding transport ATP-binding protein
  2YYZ	45%	Thermotoga maritima	Crystal structure of Sugar ABC transporter, ATP-binding protein
  4XTC	44%	Sphingomonas sp. A1	Crystal structure of bacterial alginate ABC transporter in complex with alginate pentasaccharide-bound periplasmic protein
  4XIG	44%	Sphingomonas sp. A1	Crystal structure of bacterial alginate ABC transporter determined through humid air and glue-coating method
  4TQV	44%	Sphingomonas sp.	Crystal structure of a bacterial ABC transporter involved in the import of the acidic polysaccharide alginate

• Links to additional information on cysA1:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.382 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTYAIVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGTITINGRDVTRVPPQRRGIGFVFQHYAAFKHLTVRDNVAFG
LKIRKRPKAEIKAKVDNLLQVVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDEPFGALDAKVREELRAWLRRLHDEVHVTTVLVTHDQAEALD
VADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAVSTLNGSLVRPHDIRVGRTPNMAVAAADGTAGSTGVLRAVVDRVVVLGFEVRVELTSAATGGA
FTAQITRGDAEALALREGDTVYVRATRVPPIAGGVSGVDDAGVERVKVTST

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.62 (0.37)	0.9 (0.3)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link