TB Genome Annotation Portal

Rv2382c (mbtC)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: mycobactin polyketide synthetase MbtC
  • REFSEQ: polyketide synthetase MBTC (polyketide synthase)
  • PATRIC: Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39)
  • TUBERCULIST: Polyketide synthetase MbtC (polyketide synthase)
  • NCBI: Polyketide synthetase MbtC (polyketide synthase)
  • updated information (H37Rv4):
    • gene name: mbtC
    • function:
    • reference:
• Type: Not Target
• Start: 2670269
• End: 2671603
• Operon:


• Trans-membrane region:
  
• Role: I.I - Polyketide and non-ribosomal peptide synthesis
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ACCOA[c] + MBT_HOLO[c] + MALCOA[c] -> 2 COA[c] + MBTCD_HBA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6C9U	47%	Saccharopolyspora erythraea	Crystal structure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase in complex with antibody fragment (Fab)
  2QO3	47%	Saccharopolyspora erythraea	Crystal Structure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase
  2HG4	46%	Saccharopolyspora erythraea	Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
  5BP1	40%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Condensing di-domain (KS-AT) of a mycocerosic acid synthase-like (MAS-like) PKS
  4OPE	38%	Streptomyces albus	Streptomcyes albus JA3453 oxazolomycin ketosynthase domain OzmH KS7
  4MZ0	38%	Moorea producens 3L	Structure of a ketosynthase-acyltransferase di-domain from module CurL of the curacin A polyketide synthase
  4ZDN	36%	Streptomyces platensis subsp. rosaceus	Streptomyces platensis isomigrastatin ketosynthase domain MgsF KS4
  4QYR	36%	Streptomyces platensis subsp. rosaceus	Streptomyces platensis isomigrastatin ketosynthase domain MgsE KS3
  5ERF	36%	Bacillus subtilis (strain 168)	Ketosynthase from module 6 of the bacillaene synthase from Bacillus subtilis 168
  5ENY	36%	Bacillus subtilis	Ketosynthase from module 6 connected to acyl carrier protein from module 5 (unobservable) of the bacillaene synthase from Bacillus subtilis 168

• Links to additional information on mbtC:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.685 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSDNDPVVIVGLAIEAPGGVETADDYWTLLSEQREGLGPFPTDRGWALRELFDGSRRNGFKPIHNLGGFLSSATTFDPEFFRISPREATAMDPQQRVGLR
VAWRTLENSGINPDDLAGHDVGCYVGASALEYGPALTEFSHHSGHLITGTSLGVISGRIAYTLDLAGPALTVDTSCSSALAAFHTAVQAIRAGDCDLALA
GGVCVMGTPGYFVEFSKQHALSDDGHCRPYSAHASGTAWAEGAAMFLLQRRSRATADRRRVLAEVRASCLNSDGLSDGLTAPSGDAQTRLLRRAIAQAAV
VPADVGMVEGHGTATRLGDRTELRSLAASYGTAPAGRGPLLGSVKSNIGHAQAAAGGLGLVKVILAAQHAAIPPTLHVDEPSREIDWEKQGLRLADKLTP
WRAVDGWRTAAVSAFGMSGTNSHVIVSMPDTVSAPERGPECGEV

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.34 (0.21)	1.26 (0.44)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link