TB Genome Annotation Portal

Rv2381c (mbtD)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: mycobactin polyketide synthetase MbtD
  • REFSEQ: polyketide synthetase MBTD (polyketide synthase)
  • PATRIC: Polyketide synthetase MbtD
  • TUBERCULIST: Polyketide synthetase MbtD (polyketide synthase)
  • NCBI: Polyketide synthetase MbtD (polyketide synthase)
  • updated information (H37Rv4):
    • gene name: mbtD
    • function:
    • reference:
• Type: Not Target
• Start: 2667255
• End: 2670269
• Operon:


• Trans-membrane region:
  
• Role: I.I - Polyketide and non-ribosomal peptide synthesis
• GO terms:
  • GO:0031177 - phosphopantetheine binding (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ACCOA[c] + MBT_HOLO[c] + MALCOA[c] -> 2 COA[c] + MBTCD_HBA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2HG4	36%	Saccharopolyspora erythraea	Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
  6L3N	35%	Actinosynnema pretiosum subsp. auranticum	Crystal Structure of the acyltransferase domain from the third module of the ansamitocin polyketide synthase
  6L3M	35%	Actinosynnema pretiosum subsp. auranticum	Crystal Structure of the acyltransferase domain from the third module of the ansamitocin polyketide synthase
  6J0U	35%	Actinosynnema pretiosum subsp. auranticum	Crystal Structure of the acyltransferase domain from the third module of the ansamitocin polyketide synthase

• Links to additional information on mbtD:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.823 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MAPKQLPDGRVAVLLSAHAEELIGPDARAIADYLERFPATTVTEVARQLRKTRRVRRHRAVLRAADRLELAEGLRALAAGREHPLIARSSLGSAPRQAFV
FPGQGGHWPGMGAVAYRELPTYRTATDTCAAAFAAAGVDSPLPYLIAPPGTDERQAFCEIEIEGAQFVHAVALAEVWRSCGVLPDLTVGHSLGEVAAAYL
AGSITLSDAVAVVAARANVVGRLPGRYAVAALGIGEQDASALIATTGGWLELSVVNASSTVAVSGERQAVAAIVDTVRSSGHFARGITVGFPVHTSVLES
LRDELCEQLPDSEFMEAPVQFIGGTTGDVVAPGTTFGDYWYANLRHTVRFDRAVESAIRCGARAFIEISAHPALLFAIGQNCEGAANLPDGPAVLVGSAR
RGERFVDALSANIVSAAVADPGYPWGDLGGDPLDGDVDLSGFPNAPMRAVPMWAHPEPLPPVSGLTIAVERWERMVPSTPVAGRHRHLAVLDLGAHRALA
QTLCAAIDSHPDTELSAARDAELILVIAPDFEHTDAVRAAGALADLVGAGLLDYPMHIGARCQSVCLVTVGAEQVDAADAVPSAGQAALAAMHRSIGFEH
PEQTFSHLDLPSWDLDPVLGVSVITAVLRGFGETALRGSVNGYTLFERTLADAPAVPNWSLDSGVLDDVVVTGGAGAIGMHYARYLAEHGARRIVLLSRR
AADQATVAMLRKQHGTVIVSPPCDITDPTQLSAIAAEYGGVGASLIVHAAGSVISGTAPGVTSAAVVDNFAAKVLGLAQMIELWPLRPDVRTLLCSSVMG
VWGGHGVVAYSAANRLLDVMAAQLRAQGRHCVAVKWGLWQAPKAGEPARGIADAVTIARVERSGLRQMAPQQAIEASLHEFTVDPLVFAADAARLQMLLD
SRQFERYEGPTDPNLTIVDAVRTQLAAVLGIPQAGEVNLQESLFDLGVDSMLALDLRNRLKRSIGATVSLATLMGDITGDGLVAKLEDADERSHTAQKVD
ISRD

Additional Information