TB Genome Annotation Portal

Rv2379c (mbtF)

Amino Acid Sequence

MGPVAVTRADARGAIDDVMALSPLQQGLFSRATLVAAESGSEAAEADPYVIAMAADAAGPLDIALLRDCAAAMLTRHPNLRASFLHGNLSRPVQVIPSSA
EVLWRHVRAHPSEVGALAAEERRRRFDVGRGPLIRFLLIELPDECWHLVIVAHHIVIDGWSLPLFVSELLALYRAGGHVAALPAAPRPYRDYIGWLAGRD
QTASRAMWADHLNGLDGPTLLSPALADTPVQPGIPGRTEVRLDREATAELADAARTRGVTISTLVQMAWATTLSAFTGRGDVTFGVTVSGRPSELSGVET
MIGLFINTVPLRVRLDARATVGGQCAVLQRQFAMLRDHSYLGFNEFRAIAGIGEMFDTLLVYENFPPGEVVGTAEFVANGVTFRPVALESLSHFPVTVAA
HRSTGELTLLVEVLDGALGTMAPESLGRRVLAVLQRLVSRWDRPLRDVDILLDGEHDPTAPGLPDVTTSAPAVHTRFAEIAAAQPDSVAVSWADGQLTYR
ELDALADRLATGLRRADVSRETPVAVALSRGPRYVAAMLAVLKAGGMIVPLDPAMPGERVAEILRQTSAPVVIDEGVFAASVGADILEEDRAITVPVDQA
AYVIFTSGTTGTPKGVIGTHRALSAYADDHIERVLRPAAQRLGRPLRIAHAWSFTFDAAWQPLVALLDGHAVHIVDDHRQRDAGALVEAIDRFGLDMIDT
TPSMFAQLHNAGLLDRAPLAVLALGGEALGAATWRMIQQNCARTAMTAFNCYGPTETTVEAVVAAVAEHARPVIGRPTCTTRAYVMDSWLRPVPDGVAGE
LYLAGAQLTRGYLGRPAETAARFVAEPNGRGSRMYRTGDVVRRLPDGGLEFLGRSDDQVKIRGFRVEPGEIAAVLNGHHAVHGCHVTARGHASGPRLTAY
VAGGPQPPPVAELRAMLLERLPRYLVPHHIVVLDELPLTPHGKIDENALAAINVTEGPATPPQTPTELVLAEAFADVMETSNVDVTAGFLQMGLDSIVAL
SVVQAARRRGIALRARLMVECDTIRELAAAIDSDAAWQAPANDAGEPIPVLPNTHWLYEYGDPRRLAQTEVIRLPDRITRERLDAVLAAVVDGHEVLRCR
FDRDAMALVAQPKTDILSEVWVSGELVTAVAEQTLGALASLDPQAGRLLSAVWLREPDGPGVLVLTAHVLAMDPASWRIVLGELDAGLHALAAGRAPSPA
RENTSYRQWSRLLAQRAKALDSVDFWVAELEGADPPLGARRVAPQTDRVGELAITMSISDADLTARLLSTGRSMTDLLATAAARMVTAWRRQRGQQTPAP
LLALETHGRADVHVDKTADTSDTVGLLSAIYPLRIHCDGATDFARIPGSGIDYGLLRYLRADTAERLRAHREPQLLLNYLGSLHVGVGDLAVDRALLADV
GQLPEPEQPVRHELTVLAALLGPADAPVLATRWRTLPDILSADDVATLQSLWQGALAEITA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
22 non-insertions in a row out of 64 sites
Uncertain Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.830800;
9 non-insertions in a row out of 64 sites
Uncertain Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.654500;
8 non-insertions in a row out of 64 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
18 non-insertions in a row out of 64 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.994600;
12 non-insertions in a row out of 64 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2379c (mbtF)

    PropertyValueCreatorEvidencePMIDComment
    TermEC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDAnjamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    TermTBRXN:MCBTS3 carboxymycobactin synthesis - IDAnjamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    CitationIron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Proc. Natl. Acad. Sci. U.S.A. 1995njamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    TermEC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDAnjamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
    TermTBRXN:MCBTS3 carboxymycobactin synthesis - IDAnjamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
    CitationIron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004njamshidiIDA7761471||14670352For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    CitationIron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004njamshidiISS14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    TermEC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - ISSnjamshidiISS14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    TermTBRXN:MCBTS2 mycobactin synthesis - ISSnjamshidiISS14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    CitationIron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004njamshidiIPI14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    TermEC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IPInjamshidiIPI14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    TermTBRXN:MCBTS2 mycobactin synthesis - IPInjamshidiIPI14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    InteractionRegulatory Rv2711shahanup86IEPCo-expression (Functional linkage)
    authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999
    CitationIdentification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. LE. Quadri, J. Sello et al. Chem. Biol. 1998shahanup86IEP9831524Co-expression (Functional linkage)
    InteractionRegulatory Rv2711shahanup86IEPCo-expression (Functional linkage)
    LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998
    CitationideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. GM. Rodriguez, MI. Voskuil et al. Infect. Immun. 2002shahanup86IEP12065475Co-expression (Functional linkage)
    InteractionRegulatory Rv2711shahanup86IEPCo-expression (Functional linkage)
    GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
    CitationIron acquisition and metabolism by mycobacteria. authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry J. Bacteriol. 1999shahanup86IEP10419938Co-expression (Functional linkage)
    InteractionRegulatedBy Rv2711yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002

    Comments