TB Genome Annotation Portal

Rv2379c (mbtF)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: amino acid adenylation domain-containing protein
  • REFSEQ: peptide synthetase MBTF (peptide synthase)
  • PATRIC: Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)
  • TUBERCULIST: Peptide synthetase MbtF (peptide synthase)
  • NCBI: Peptide synthetase MbtF (peptide synthase)
  • updated information (H37Rv4):
    • gene name: mbtF
    • function:
    • reference:
• Type: Not Target
• Start: 2657700
• End: 2662085
• Operon:


• Trans-membrane region:
  
• Role: I.I - Polyketide and non-ribosomal peptide synthesis
• GO terms:
  • GO:0031177 - phosphopantetheine binding (Uniprot)
  • GO:0016874 - ligase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6EBY	65%	Thermobifida fusca (strain YX)	Crystal structure of the MbtH-like protein FscK bound to the interface forming region of FscH adenylation domain from Thermobifida fusca
  5WMM	40%	Micromonospora sp. ML1	Crystal structure of an adenylation domain interrupted by a methylation domain (AMA4) from nonribosomal peptide synthetase TioS
  6EA3	39%	Thermobifida fusca (strain YX)	Thermobifida fusca FscH adenylation domain complexed with MbtH-like protein FscK and Ser-AMP
  4GR5	39%	Streptomyces lydicus	Crystal structure of SlgN1deltaAsub in complex with AMPcPP
  4GR4	36%	Streptomyces lydicus	Crystal structure of SlgN1deltaAsub
  5ES7	35%	Brevibacillus parabrevis	Crystal structure of the F-A domains of the LgrA initiation module soaked with FON, AMPcPP, and valine.
  5ES6	35%	Brevibacillus parabrevis	Crystal structure of the first two domains of the initiation module of LgrA
  6ULZ	35%	Brevibacillus parabrevis	Adenylation domain of the initiation module of LgrA mutant P483M

• Links to additional information on mbtF:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.01 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MGPVAVTRADARGAIDDVMALSPLQQGLFSRATLVAAESGSEAAEADPYVIAMAADAAGPLDIALLRDCAAAMLTRHPNLRASFLHGNLSRPVQVIPSSA
EVLWRHVRAHPSEVGALAAEERRRRFDVGRGPLIRFLLIELPDECWHLVIVAHHIVIDGWSLPLFVSELLALYRAGGHVAALPAAPRPYRDYIGWLAGRD
QTASRAMWADHLNGLDGPTLLSPALADTPVQPGIPGRTEVRLDREATAELADAARTRGVTISTLVQMAWATTLSAFTGRGDVTFGVTVSGRPSELSGVET
MIGLFINTVPLRVRLDARATVGGQCAVLQRQFAMLRDHSYLGFNEFRAIAGIGEMFDTLLVYENFPPGEVVGTAEFVANGVTFRPVALESLSHFPVTVAA
HRSTGELTLLVEVLDGALGTMAPESLGRRVLAVLQRLVSRWDRPLRDVDILLDGEHDPTAPGLPDVTTSAPAVHTRFAEIAAAQPDSVAVSWADGQLTYR
ELDALADRLATGLRRADVSRETPVAVALSRGPRYVAAMLAVLKAGGMIVPLDPAMPGERVAEILRQTSAPVVIDEGVFAASVGADILEEDRAITVPVDQA
AYVIFTSGTTGTPKGVIGTHRALSAYADDHIERVLRPAAQRLGRPLRIAHAWSFTFDAAWQPLVALLDGHAVHIVDDHRQRDAGALVEAIDRFGLDMIDT
TPSMFAQLHNAGLLDRAPLAVLALGGEALGAATWRMIQQNCARTAMTAFNCYGPTETTVEAVVAAVAEHARPVIGRPTCTTRAYVMDSWLRPVPDGVAGE
LYLAGAQLTRGYLGRPAETAARFVAEPNGRGSRMYRTGDVVRRLPDGGLEFLGRSDDQVKIRGFRVEPGEIAAVLNGHHAVHGCHVTARGHASGPRLTAY
VAGGPQPPPVAELRAMLLERLPRYLVPHHIVVLDELPLTPHGKIDENALAAINVTEGPATPPQTPTELVLAEAFADVMETSNVDVTAGFLQMGLDSIVAL
SVVQAARRRGIALRARLMVECDTIRELAAAIDSDAAWQAPANDAGEPIPVLPNTHWLYEYGDPRRLAQTEVIRLPDRITRERLDAVLAAVVDGHEVLRCR
FDRDAMALVAQPKTDILSEVWVSGELVTAVAEQTLGALASLDPQAGRLLSAVWLREPDGPGVLVLTAHVLAMDPASWRIVLGELDAGLHALAAGRAPSPA
RENTSYRQWSRLLAQRAKALDSVDFWVAELEGADPPLGARRVAPQTDRVGELAITMSISDADLTARLLSTGRSMTDLLATAAARMVTAWRRQRGQQTPAP
LLALETHGRADVHVDKTADTSDTVGLLSAIYPLRIHCDGATDFARIPGSGIDYGLLRYLRADTAERLRAHREPQLLLNYLGSLHVGVGDLAVDRALLADV
GQLPEPEQPVRHELTVLAALLGPADAPVLATRWRTLPDILSADDVATLQSLWQGALAEITA

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.39 (0.25)	1.81 (0.58)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link