TB Genome Annotation Portal

Rv2379c (mbtF)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: amino acid adenylation domain-containing protein
  • REFSEQ: peptide synthetase MBTF (peptide synthase)
  • PATRIC: Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)
  • TUBERCULIST: Peptide synthetase MbtF (peptide synthase)
  • NCBI: Peptide synthetase MbtF (peptide synthase)
  • updated information (H37Rv4):
    • gene name: mbtF
    • function:
    • reference:
• Coordinates in H37Rv: 2657700 - 2662085
• Gene length: 4386 bp (with stop codon), 1461 aa (without stop codon)
• Operon:


• Trans-membrane region:
  
• Role: I.I - Polyketide and non-ribosomal peptide synthesis
• GO terms:
  • GO:0031177 - phosphopantetheine binding (Uniprot)
  • GO:0016874 - ligase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Latest Homologs in PDB
• Top 10 Homologs in PDB (as of Apr 2026):
  

  PDB	aa ident	species	PDB title
  6EBY	65%	Thermobifida fusca (strain YX)	Crystal structure of the MbtH-like protein FscK bound to the interface forming region of FscH adenylation domain from Thermobifida fusca
  5WMM	40%	Micromonospora sp. ML1	Crystal structure of an adenylation domain interrupted by a methylation domain (AMA4) from nonribosomal peptide synthetase TioS
  6EA3	39%	Thermobifida fusca (strain YX)	Thermobifida fusca FscH adenylation domain complexed with MbtH-like protein FscK and Ser-AMP
  4GR5	39%	Streptomyces lydicus	Crystal structure of SlgN1deltaAsub in complex with AMPcPP
  8WWW	38%	Streptomyces yokosukanensis	Crystal structure of the adenylation domain of SyAstC
  8GLC	38%	Actinoplanes	A1 AncAla: Adenylation domain 1 core construct from ancestral reconstruction of glycopeptide antibiotic biosynthesis, alanine selection pocket
  8GJP	37%	Actinoplanes teichomyceticus	A1 Int graft: Adenylation domain 1 core construct from teicoplanin biosynthesis, intermediate selection pocket graft
  9DVH	37%	Actinoplanes teichomyceticus	A1 Tei + D-Hpg: Adenylation Domain 1 Core Construct from Teicoplanin Biosynthesis with D-4-Hydroxyphenylglycine
  8GKM	37%	Actinoplanes teichomyceticus	A1 Leu graft + Leu: Adenylation domain 1 core construct from teicoplanin biosynthesis, leucine selection pocket graft; leucine bound
  8GJ4	37%	Actinoplanes teichomyceticus	A1 Tei: Adenylation domain 1 core construct from teicoplanin biosynthesis

• Links to additional information on mbtF:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.01 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MGPVAVTRADARGAIDDVMALSPLQQGLFSRATLVAAESGSEAAEADPYVIAMAADAAGPLDIALLRDCAAAMLTRHPNLRASFLHGNLSRPVQVIPSSA
EVLWRHVRAHPSEVGALAAEERRRRFDVGRGPLIRFLLIELPDECWHLVIVAHHIVIDGWSLPLFVSELLALYRAGGHVAALPAAPRPYRDYIGWLAGRD
QTASRAMWADHLNGLDGPTLLSPALADTPVQPGIPGRTEVRLDREATAELADAARTRGVTISTLVQMAWATTLSAFTGRGDVTFGVTVSGRPSELSGVET
MIGLFINTVPLRVRLDARATVGGQCAVLQRQFAMLRDHSYLGFNEFRAIAGIGEMFDTLLVYENFPPGEVVGTAEFVANGVTFRPVALESLSHFPVTVAA
HRSTGELTLLVEVLDGALGTMAPESLGRRVLAVLQRLVSRWDRPLRDVDILLDGEHDPTAPGLPDVTTSAPAVHTRFAEIAAAQPDSVAVSWADGQLTYR
ELDALADRLATGLRRADVSRETPVAVALSRGPRYVAAMLAVLKAGGMIVPLDPAMPGERVAEILRQTSAPVVIDEGVFAASVGADILEEDRAITVPVDQA
AYVIFTSGTTGTPKGVIGTHRALSAYADDHIERVLRPAAQRLGRPLRIAHAWSFTFDAAWQPLVALLDGHAVHIVDDHRQRDAGALVEAIDRFGLDMIDT
TPSMFAQLHNAGLLDRAPLAVLALGGEALGAATWRMIQQNCARTAMTAFNCYGPTETTVEAVVAAVAEHARPVIGRPTCTTRAYVMDSWLRPVPDGVAGE
LYLAGAQLTRGYLGRPAETAARFVAEPNGRGSRMYRTGDVVRRLPDGGLEFLGRSDDQVKIRGFRVEPGEIAAVLNGHHAVHGCHVTARGHASGPRLTAY
VAGGPQPPPVAELRAMLLERLPRYLVPHHIVVLDELPLTPHGKIDENALAAINVTEGPATPPQTPTELVLAEAFADVMETSNVDVTAGFLQMGLDSIVAL
SVVQAARRRGIALRARLMVECDTIRELAAAIDSDAAWQAPANDAGEPIPVLPNTHWLYEYGDPRRLAQTEVIRLPDRITRERLDAVLAAVVDGHEVLRCR
FDRDAMALVAQPKTDILSEVWVSGELVTAVAEQTLGALASLDPQAGRLLSAVWLREPDGPGVLVLTAHVLAMDPASWRIVLGELDAGLHALAAGRAPSPA
RENTSYRQWSRLLAQRAKALDSVDFWVAELEGADPPLGARRVAPQTDRVGELAITMSISDADLTARLLSTGRSMTDLLATAAARMVTAWRRQRGQQTPAP
LLALETHGRADVHVDKTADTSDTVGLLSAIYPLRIHCDGATDFARIPGSGIDYGLLRYLRADTAERLRAHREPQLLLNYLGSLHVGVGDLAVDRALLADV
GQLPEPEQPVRHELTVLAALLGPADAPVLATRWRTLPDILSADDVATLQSLWQGALAEITA

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• data from Culviner et al (2025) (55,259 Mtb clinical isolates)
  • overall pN/pS for Rv2379c: 0.541102956
  • lineage-specific pN/pS in L1: 0.586177028
  • lineage-specific pN/pS in L2: 0.615059348
  • lineage-specific pN/pS in L3: 0.498075468
  • lineage-specific pN/pS in L4: 0.515775067

• Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
• clinical isolates collection: global set of 10,626 Mtb genomes
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	global set of 10,626 Mtb clinical isolates
under significant positive selection?	NO
omega peak height (95%CI lower bound)	1.53 (0.58)
codons under selection
omega plots
genetic variants*	link