TB Genome Annotation Portal

Rv2377c (mbtH)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: protein mbtH
  • REFSEQ: putative protein MbtH
  • PATRIC: Protein MbtH
  • TUBERCULIST: Putative conserved protein MbtH
  • NCBI: Putative conserved protein MbtH
  • updated information (H37Rv4):
    • gene name: mbtH
    • function:
    • reference:
• Type: Not Target
• Start: 2656215
• End: 2656430
• Operon:


• Trans-membrane region:
  
• Role: I.I - Polyketide and non-ribosomal peptide synthesis
• GO terms:
  • No terms assigned.
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2khr
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2KHR	98%	Mycobacterium tuberculosis	Solution structure of Rv2377c, a MbtH-like protein from Mycobacterium tuberculosis
  2N6G	76%	Mycobacterium avium 104	Solution structure of an MbtH-like protein from Mycobacterium avium, Seattle Structural Genomics Center for Infectious Disease target MyavA.01649.c
  6EBY	71%	Thermobifida fusca (strain YX)	Crystal structure of the MbtH-like protein FscK bound to the interface forming region of FscH adenylation domain from Thermobifida fusca
  6EA3	71%	Thermobifida fusca (strain YX)	Thermobifida fusca FscH adenylation domain complexed with MbtH-like protein FscK and Ser-AMP
  2MYY	69%	Mycobacterium marinum M	Solution structure of an MbtH-like protein from Mycobacterium marinum, Seattle Structural Genomics Center for Infectious Disease target MymaA.01649.c
  5WMM	67%	Micromonospora sp. ML1	Crystal structure of an adenylation domain interrupted by a methylation domain (AMA4) from nonribosomal peptide synthetase TioS
  6N8E	58%	Burkholderia diffusa	Crystal structure of holo-ObiF1, a five domain nonribosomal peptide synthetase from Burkholderia diffusa
  5U89	49%	Geobacillus sp.	Crystal structure of a cross-module fragment from the dimodular NRPS DhbF
  4GR5	49%	Streptomyces lydicus	Crystal structure of SlgN1deltaAsub in complex with AMPcPP
  4GR4	49%	Streptomyces lydicus	Crystal structure of SlgN1deltaAsub

• Links to additional information on mbtH:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.153 (from Jeremy Rock's lab)

Amino Acid Sequence

VSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLRPKSLRDAMVED

Additional Information