TB Genome Annotation Portal

Rv2361c (-)

Amino Acid Sequence

VARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAPRIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVV
IDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTE
ITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.999800;
17 non-insertions in a row out of 17 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
17 non-insertions in a row out of 17 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
17 non-insertions in a row out of 17 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
17 non-insertions in a row out of 18 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.999950;
17 non-insertions in a row out of 18 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.08
Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2361c (-)

    PropertyValueCreatorEvidencePMIDComment
    CitationIdentification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. MC. Schulbach, PJ. Brennan et al. J. Biol. Chem. 2000njamshidiISS10816587|15516568PMID: 15516568, 10816587
    TermEC:2.5.1.31 diphosphate specific). - ISSnjamshidiISS10816587|15516568PMID: 15516568, 10816587
    MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
    TermTBRXN:UDPDPS2 undecaprenyl-diphosphate synthase - ISSnjamshidiISS10816587|15516568PMID: 15516568, 10816587
    MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
    TermEC:2.5.1.31 diphosphate specific). - ISSnjamshidiISS10816587|15516568PMID: 15516568, 10816587
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    TermTBRXN:UDPDPS undecaprenyl-diphosphate synthase - ISSnjamshidiISS10816587|15516568PMID: 15516568, 10816587
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    CitationIdentification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. MC. Schulbach, PJ. Brennan et al. J. Biol. Chem. 2000njamshidiISS10816587|15516568PMID: 15516568, 10816587
    TermEC:2.5.1.31 diphosphate specific). - ISSnjamshidiISS10816587|15516568PMID: 15516568, 10816587
    MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
    TermTBRXN:UDPDPS undecaprenyl-diphosphate synthase - ISSnjamshidiISS10816587|15516568PMID: 15516568, 10816587
    MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
    CitationDecaprenyl diphosphate synthesis in Mycobacterium tuberculosis. D. Kaur, PJ. Brennan et al. J. Bacteriol. 2004njamshidiIDA10816587|15516568PMID: 15516568, 10816587
    TermEC:2.5.1.31 diphosphate specific). - IDAnjamshidiIDA10816587|15516568PMID: 15516568, 10816587
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    TermTBRXN:UDPDPS2 undecaprenyl-diphosphate synthase - IDAnjamshidiIDA10816587|15516568PMID: 15516568, 10816587
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    CitationIdentification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. MC. Schulbach, PJ. Brennan et al. J. Biol. Chem. 2000njamshidiIDA10816587|15516568PMID: 15516568, 10816587
    TermEC:2.5.1.31 diphosphate specific). - IDAnjamshidiIDA10816587|15516568PMID: 15516568, 10816587
    MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
    TermTBRXN:UDPDPS2 undecaprenyl-diphosphate synthase - IDAnjamshidiIDA10816587|15516568PMID: 15516568, 10816587
    MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
    CitationDecaprenyl diphosphate synthesis in Mycobacterium tuberculosis. D. Kaur, PJ. Brennan et al. J. Bacteriol. 2004njamshidiISS10816587|15516568PMID: 15516568, 10816587
    TermEC:2.5.1.31 diphosphate specific). - ISSnjamshidiISS10816587|15516568PMID: 15516568, 10816587
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    TermTBRXN:UDPDPS2 undecaprenyl-diphosphate synthase - ISSnjamshidiISS10816587|15516568PMID: 15516568, 10816587
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    CitationDecaprenyl diphosphate synthesis in Mycobacterium tuberculosis. D. Kaur, PJ. Brennan et al. J. Bacteriol. 2004njamshidiIDA10816587|15516568PMID: 15516568, 10816587
    TermEC:2.5.1.31 diphosphate specific). - IDAnjamshidiIDA10816587|15516568PMID: 15516568, 10816587
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    TermTBRXN:UDPDPS undecaprenyl-diphosphate synthase - IDAnjamshidiIDA10816587|15516568PMID: 15516568, 10816587
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    CitationIdentification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. MC. Schulbach, PJ. Brennan et al. J. Biol. Chem. 2000njamshidiIDA10816587|15516568PMID: 15516568, 10816587
    TermEC:2.5.1.31 diphosphate specific). - IDAnjamshidiIDA10816587|15516568PMID: 15516568, 10816587
    MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
    TermTBRXN:UDPDPS undecaprenyl-diphosphate synthase - IDAnjamshidiIDA10816587|15516568PMID: 15516568, 10816587
    MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
    CitationDecaprenyl diphosphate synthesis in Mycobacterium tuberculosis. D. Kaur, PJ. Brennan et al. J. Bacteriol. 2004njamshidiISS10816587|15516568PMID: 15516568, 10816587
    SymboluppSmjacksonIDAPrenyl diphosphate synthases
    NameLong (C50) chain Z-isoprenyl diphosphate synthasemjacksonIDAPrenyl diphosphate synthases
    TermEC:2.5.1.31 Di-trans,poly-cis-decaprenylcistransferase. - NRjjmcfaddenNRInferred from direct assay
    D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
    CitationDecaprenyl diphosphate synthesis in Mycobacterium tuberculosis. D. Kaur, PJ. Brennan et al. J. Bacteriol. 2004jjmcfadden15516568Inferred from direct assay

    Comments