Rv2268c (cyp128)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: cytochrome P450 128 cyp128
- REFSEQ: cytochrome P450 128
- PATRIC: Cytochrome P450 128
- TUBERCULIST: Probable cytochrome P450 128 Cyp128
- NCBI: Probable cytochrome P450 128 Cyp128
- updated information (H37Rv4):
  - gene name: cyp128
  - function: makes S881
  - reference: Sogi (2016); PMID: 27933784
Type: Not Target
Start: 2542807
End: 2544276
Operon:

Trans-membrane region:
Role: IV.F - Cytochrome P450 enzymes
GO terms:
- GO:0055114 - oxidation-reduction process (Uniprot)
- GO:0046872 - metal ion binding (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0020037 - heme binding (Uniprot)
- GO:0016705 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (Uniprot)
- GO:0016491 - oxidoreductase activity (Uniprot)
- GO:0016125 - sterol metabolic process (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005506 - iron ion binding (Uniprot)
- GO:0004497 - monooxygenase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on cyp128:
- KEGG - nucleotide and amino acid sequences of gene
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.19 (from Jeremy Rock's lab)
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTATQSPPEPAPDRVRLAGCPLAGTPDVGLTAQDATTALGVPTRRRASSGGIPVATSMWRDAQTVRTYGPAVAKALALRVAGKARSRLTGRHCRKFMQLT
DFDPFDPAIAADPYPHYRELLAGERVQYNPKRDVYILSRYADVREAARNHDTLSSARGVTFSRGWLPFLPTSDPPAHTRMRKQLAPGMARGALETWRPMV
DQLARELVGGLLTQTPADVVSTVAAPMPMRAITSVLGVDGPDEAAFCRLSNQAVRITDVALSASGLISLVQGFAGFRRLRALFTHRRDNGLLRECTVLGK
LATHAEQGRLSDDELFFFAVLLLVAGYESTAHMISTLFLTLADYPDQLTLLAQQPDLIPSAIEEHLRFISPIQNICRTTRVDYSVGQAVIPAGSLVLLAW
GAANRDPRQYEDPDVFRADRNPVGHLAFGSGIHLCPGTQLARMEGQAILREIVANIDRIEVVEPPTWTTNANLRGLTRLRVAVTPRVAP

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.383450; 7 non-insertions in a row out of 28 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 28 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 28 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.875900; 8 non-insertions in a row out of 28 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.954200; 9 non-insertions in a row out of 28 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.15
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0678 (-) (Direct binding)
- Rv0081 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv1776c (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Activation Rv2269c	swetha.r	TAS		authors,MD. Driscoll,KJ. McLean,MR. Cheesman,TA. Jowitt,M. Howard,P. Carroll,T. Parish,AW. Munro Expression and characterization of Mycobacterium tuberculosis CYP144: common themes and lessons learned in the M. tuberculosis P450 enzyme family. Biochim. Biophys. Acta 2011
Interaction	Activation Rv2269c	swetha.r	TAS		CM. Holsclaw,KM. Sogi,SA. Gilmore,MW. Schelle,MD. Leavell,CR. Bertozzi,JA. Leary Structural characterization of a novel sulfated menaquinone produced by stf3 from Mycobacterium tuberculosis. ACS Chem. Biol. 2008

TB Genome Annotation Portal