TB Genome Annotation Portal

Rv2268c (cyp128)

Amino Acid Sequence

MTATQSPPEPAPDRVRLAGCPLAGTPDVGLTAQDATTALGVPTRRRASSGGIPVATSMWRDAQTVRTYGPAVAKALALRVAGKARSRLTGRHCRKFMQLT
DFDPFDPAIAADPYPHYRELLAGERVQYNPKRDVYILSRYADVREAARNHDTLSSARGVTFSRGWLPFLPTSDPPAHTRMRKQLAPGMARGALETWRPMV
DQLARELVGGLLTQTPADVVSTVAAPMPMRAITSVLGVDGPDEAAFCRLSNQAVRITDVALSASGLISLVQGFAGFRRLRALFTHRRDNGLLRECTVLGK
LATHAEQGRLSDDELFFFAVLLLVAGYESTAHMISTLFLTLADYPDQLTLLAQQPDLIPSAIEEHLRFISPIQNICRTTRVDYSVGQAVIPAGSLVLLAW
GAANRDPRQYEDPDVFRADRNPVGHLAFGSGIHLCPGTQLARMEGQAILREIVANIDRIEVVEPPTWTTNANLRGLTRLRVAVTPRVAP
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2268c/cyp128, gene len: 1469 bp, num TA sites: 28
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathuncertainM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=5.05)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.542)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.48)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.91 (0.76)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2268c/cyp128Rv3286c/sigF4.03
    Rv2268c/cyp128Rv0818/glnR3.18
    Rv2268c/cyp128Rv3260c/whiB23.11
    Rv2268c/cyp128Rv1776c/--1.28


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2268c (cyp128)

    PropertyValueCreatorEvidencePMIDComment
    InteractionActivation Rv2269cswetha.rTAS
    authors,MD. Driscoll,KJ. McLean,MR. Cheesman,TA. Jowitt,M. Howard,P. Carroll,T. Parish,AW. Munro Expression and characterization of Mycobacterium tuberculosis CYP144: common themes and lessons learned in the M. tuberculosis P450 enzyme family. Biochim. Biophys. Acta 2011
    InteractionActivation Rv2269cswetha.rTAS
    CM. Holsclaw,KM. Sogi,SA. Gilmore,MW. Schelle,MD. Leavell,CR. Bertozzi,JA. Leary Structural characterization of a novel sulfated menaquinone produced by stf3 from Mycobacterium tuberculosis. ACS Chem. Biol. 2008

    Comments