TB Genome Annotation Portal

Rv2231c (cobC)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: histidinol-phosphate aminotransferase
  • REFSEQ: hypothetical protein
  • PATRIC: L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)
  • TUBERCULIST: Possible aminotransferase CobC
  • NCBI: Possible aminotransferase CobC
  • updated information (H37Rv4):
    • gene name: cobC
    • function:
    • reference:
• Type: Conditional
• Start: 2504605
• End: 2505699
• Operon:


• Trans-membrane region:
  
• Role: I.G.13 - Cobalamin
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0030170 - pyridoxal phosphate binding (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0009058 - biosynthetic process (Uniprot)
  • GO:0008483 - transaminase activity (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 1_AMINO_PROPAN_2_OL[c] + ADENOSYL_COBRATE[c] -> ADENOSYLCOBINAMIDE[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2GB3	35%	Thermotoga maritima	Crystal structure of Aspartate aminotransferase (tm1698) from Thermotoga maritima at 2.50 A resolution

• Links to additional information on cobC:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.907 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VLWILGPHTGPLLFDAVASLDTSPLAAARYHGDQDVAPGVLDFAVNVRHDRPPEWLVRQLAALLPELARYPSTDDVHRAQDAVAERHGRTRDEVLPLVGA
AEGFALLHNLSPVRAAIVVPAFTEPAIALSAAGITAHHVVLKPPFVLDTAHVPDDADLVVVGNPTNPTSVLHLREQLLELRRPGRILVVDEAFADWVPGE
PQSLADDSLPDVLVLRSLTKTWSLAGLRVGYALGSPDVLARLTVQRAHWPLGTLQLTAIAACCAPRAVAAAAADAVRLTALRAEMVAGLRSVGAEVVDGA
APFVLFNIADADGLRNYLQSKGIAVRRGDTFVGLDARYLRAAVRPEWPVLVAAIAEWAKRGGRR

Additional Information