Rv2188c (pimB)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
REFSEQ: hypothetical protein
PATRIC: Poly(glycerol-phosphate) alpha-glucosyltransferase (EC 2.4.1.52)
TUBERCULIST: Mannosyltransferase PimB
NCBI: Mannosyltransferase PimB
updated information (H37Rv4):
gene name: pimB
function:
reference:
Coordinates in H37Rv: 2449993 - 2451150
Gene length: 1158 bp (with stop codon), 385 aa (without stop codon)
Operon:
Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
GO:0097502 - mannosylation (Uniprot)
GO:0046488 - phosphatidylinositol metabolic process (Uniprot)
GO:0043750 - phosphatidylinositol alpha-mannosyltransferase activity (Uniprot)
GO:0040007 - growth (Uniprot)
GO:0033164 - glycolipid 6-alpha-mannosyltransferase activity (Uniprot)
GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
GO:0016740 - transferase activity (Uniprot)
GO:0009405 - pathogenesis (Uniprot)
GO:0009247 - glycolipid biosynthetic process (Uniprot)
GO:0008654 - phospholipid biosynthetic process (Uniprot)
GO:0006629 - lipid metabolic process (Uniprot)
GO:0005886 - plasma membrane (Uniprot)
GO:0000030 - mannosyltransferase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 3OKP 50% Corynebacterium glutamicum Crystal structure of Corynebacterium glutamicum PimB' bound to GDP-Man (orthorhombic crystal form) 3OKC 50% Corynebacterium glutamicum Crystal structure of Corynebacterium glutamicum PimB' bound to GDP (orthorhombic crystal form) 3OKA 50% Corynebacterium glutamicum Crystal structure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form)
Links to additional information on pimB:
Amino Acid Sequence
VSRVLLVTNDFPPRRGGIQSYLGEFVGRLVGSRAHAMTVYAPQWKGADAFDDAARAAGYRVVRHPSTVMLPGPTVDVRMRRLIAEHDIETVWFGAAAPLA
LLAPRARLAGASRVLASTHGHEVGWSMLPVARSVLRRIGDGTDVVTFVSSYTRSRFASAFGPAASLEYLPPGVDTDRFRPDPAARAELRKRYRLGERPTV
VCLSRLVPRKGQDTLVTALPSIRRRVDGAALVIVGGGPYLETLRKLAHDCGVADHVTFTGGVATDELPAHHALADVFAMPCRTRGAGMDVEGLGIVFLEA
SAAGVPVIAGNSGGAPETVQHNKTGLVVDGRSVDRVADAVAELLIDRDRAVAMGAAGREWVTAQWRWDTLAAKLADFLRGDDAAR
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv2188c/pimB,
gene len: 1157 bp, num TA sites: 19
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=0.0) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.0) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.0) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv2188c: 0.569867319
lineage-specific pN/pS in L1: 0.685165485
lineage-specific pN/pS in L2: 0.387950236
lineage-specific pN/pS in L3: 0.414705425
lineage-specific pN/pS in L4: 0.715009354
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? YES
omega peak height (95%CI lower bound) 2.67 (1.16)
codons under selection 381, 382, 383
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Name GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase mjackson IDA PIM, LM and LAM biosynthesis
Symbol pimB' mjackson IMP PIM, LM and LAM biosynthesis
Name GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase mjackson IMP PIM, LM and LAM biosynthesis
Symbol pimB' mjackson IDA PIM, LM and LAM biosynthesis
Other TBPWY:PIM, LM and LAM biosynthesis mjackson GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)ME. Guerin, D. Kaur et al. New insights into the early steps of phosphatidylinositol mannoside biosynthesis in mycobacteria: PimB' is an essential enzyme of Mycobacterium smegmatis. J. Biol. Chem. 2009
Symbol pimB' mjackson GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)DJ. Lea-Smith, KL. Martin et al. Analysis of a new mannosyltransferase required for the synthesis of phosphatidylinositol mannosides and lipoarbinomannan reveals two lipomannan pools in corynebacterineae. J. Biol. Chem. 2008
Citation Analysis of a new mannosyltransferase required for the synthesis of phosphatidylinositol mannosides and lipoarbinomannan reveals two lipomannan pools in corynebacterineae. DJ. Lea-Smith, KL. Martin et al. J. Biol. Chem. 2008 mjackson 18178556 GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)DJ. Lea-Smith, KL. Martin et al. Analysis of a new mannosyltransferase required for the synthesis of phosphatidylinositol mannosides and lipoarbinomannan reveals two lipomannan pools in corynebacterineae. J. Biol. Chem. 2008
Symbol pimB' mjackson GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)AK. Mishra, S. Batt et al. Characterization of the Corynebacterium glutamiucm{Delta}pimB'{Delta}mgtA double deletion mutant and the role of Mycobacterium tuberculosis orthologoues Rv2188c and Rv0557 in glycolipid biosynthesis. J. Bacteriol. 2009
Citation Characterization of the Corynebacterium glutamiucm{Delta}pimB'{Delta}mgtA double deletion mutant and the role of Mycobacterium tuberculosis orthologoues Rv2188c and Rv0557 in glycolipid biosynthesis. AK. Mishra, S. Batt et al. J. Bacteriol. 2009 mjackson 19395496 GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)AK. Mishra, S. Batt et al. Characterization of the Corynebacterium glutamiucm{Delta}pimB'{Delta}mgtA double deletion mutant and the role of Mycobacterium tuberculosis orthologoues Rv2188c and Rv0557 in glycolipid biosynthesis. J. Bacteriol. 2009
Symbol pimB' mjackson GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)ME. Guerin, D. Kaur et al. New insights into the early steps of phosphatidylinositol mannoside biosynthesis in mycobacteria: PimB' is an essential enzyme of Mycobacterium smegmatis. J. Biol. Chem. 2009
Citation New insights into the early steps of phosphatidylinositol mannoside biosynthesis in mycobacteria: PimB' is an essential enzyme of Mycobacterium smegmatis. ME. Guerin, D. Kaur et al. J. Biol. Chem. 2009 mjackson 19638342 GDP-Man-dependent alpha-1,6-phosphatidylinositol mannosyltransferase (phenotypic [corynebacterial recombinant strains]; enzymatic)