Rv2174 (mptA)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: carotene biosynthesis associated membrane protein
- REFSEQ: integral membrane protein
- PATRIC: Carotene biosynthesis associated membrane protein
- TUBERCULIST: Alpha(1->6)mannosyltransferase. Possible conserved integral membrane protein.
- NCBI: Alpha(1->6)mannosyltransferase Possible conserved integral membrane protein
- updated information (H37Rv4):
  - gene name: mptA
  - function: LAM biosynthesis
  - reference:
Type: Essential
Start: 2435909
End: 2437459
Operon:

Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
- GO:0097502 - mannosylation (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0009247 - glycolipid biosynthetic process (Uniprot)
- GO:0000030 - mannosyltransferase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on mptA:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -3.652 (from Jeremy Rock's lab)

Amino Acid Sequence

MTTPSHAPAVDLATAKDAVVQHLSRLFEFTTGPQGGPARLGFAGAVLITAGGLGAGSVRQHDPLLESIHMSWLRFGHGLVLSSILLWTGVGVMLLAWLGL
GRRVLAGEATEFTMRATTVIWLAPLLLSVPVFSRDTYSYLAQGALLRDGLDPYAVGPVGNPNALLDDVSPIWTITTAPYGPAFILVAKFVTVIVGNNVVA
GTMLLRLCMLPGLALLVWATPRLASHLGTHGPTALWICVLNPLVLIHLMGGVHNEMLMVGLMTAGIALTVQGRNVAGIILITVAIAVKATAGIALPFLVW
VWLRHLRERRGYRPVQAFLAAAAISLLIFVAVFAVLSAVAGVGLGWLTALAGSVKIINWLTVPTGAANVIHALGRGLFTVDFYTLLRITRLIGIVIIAVS
LPLLWWRFRRDDRAALTGVAWSMLIVVLFVPAALPWYYSWPLAVAAPLAQARRAIAAIAGLSTWVMVIFKPDGSHGMYSWLHFWIATACALTAWYVLYRS
PDRRGVQAATPVVNTP

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 26 non-insertions in a row out of 27 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 26 non-insertions in a row out of 27 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 26 non-insertions in a row out of 27 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 24 non-insertions in a row out of 28 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 25 non-insertions in a row out of 28 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.04
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0022c (whiB5) (Direct binding)
- Rv0678 (-) (Direct binding)
- Rv1353c (-) (Direct binding)
- Rv1816 (-) (Direct binding)
- Rv0081 (-) (Upstream of operon)
- Rv0880 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)

Property	Value	Creator	Evidence	PMID	Comment
Symbol	mptA	mjackson	IMP		PIM, LM and LAM biosynthesis
Name	Polyprenol phosphomannose-dependent alpha-1,6-mannosyltransferase involved in LM elongation	mjackson	IMP		PIM, LM and LAM biosynthesis
Symbol	mptA	mjackson	IDA		PIM, LM and LAM biosynthesis
Name	Polyprenol phosphomannose-dependent alpha-1,6-mannosyltransferase involved in LM elongation	mjackson	IDA		PIM, LM and LAM biosynthesis
Citation	New insights into the biosynthesis of mycobacterial lipomannan arising from deletion of a conserved gene. D. Kaur, MR. McNeil et al. J. Biol. Chem. 2007	mjackson		17606615	Polyprenol phosphomannose-dependent alpha-1,6-mannosyltransferase involved in LM elongation (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other	TBPWY:PIM, LM and LAM biosynthesis	mjackson			Polyprenol phosphomannose-dependent alpha-1,6-mannosyltransferase involved in LM elongation (phenotypic [mycobacterial recombinant strains]; enzymatic) D. Kaur, MR. McNeil et al. New insights into the biosynthesis of mycobacterial lipomannan arising from deletion of a conserved gene. J. Biol. Chem. 2007
Symbol	mptA	mjackson			Polyprenol phosphomannose-dependent alpha-1,6-mannosyltransferase involved in LM elongation (phenotypic [mycobacterial recombinant strains]; enzymatic) AK. Mishra, LJ. Alderwick et al. Identification of an alpha(1-->6) mannopyranosyltransferase (MptA), involved in Corynebacterium glutamicum lipomanann biosynthesis, and identification of its orthologue in Mycobacterium tuberculosis. Mol. Microbiol. 2007
Citation	Identification of an alpha(1-->6) mannopyranosyltransferase (MptA), involved in Corynebacterium glutamicum lipomanann biosynthesis, and identification of its orthologue in Mycobacterium tuberculosis. AK. Mishra, LJ. Alderwick et al. Mol. Microbiol. 2007	mjackson		17714444	Polyprenol phosphomannose-dependent alpha-1,6-mannosyltransferase involved in LM elongation (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other	TBPWY:PIM, LM and LAM biosynthesis	mjackson			Polyprenol phosphomannose-dependent alpha-1,6-mannosyltransferase involved in LM elongation (phenotypic [mycobacterial recombinant strains]; enzymatic) AK. Mishra, LJ. Alderwick et al. Identification of an alpha(1-->6) mannopyranosyltransferase (MptA), involved in Corynebacterium glutamicum lipomanann biosynthesis, and identification of its orthologue in Mycobacterium tuberculosis. Mol. Microbiol. 2007
Symbol	mptA	mjackson			Polyprenol phosphomannose-dependent alpha-1,6-mannosyltransferase involved in LM elongation (phenotypic [mycobacterial recombinant strains]; enzymatic) D. Kaur, MR. McNeil et al. New insights into the biosynthesis of mycobacterial lipomannan arising from deletion of a conserved gene. J. Biol. Chem. 2007

TB Genome Annotation Portal