TB Genome Annotation Portal

Rv2155c (murD)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: UDP-N-acetylmuramoylalanine-D-glutamate ligase
  • REFSEQ: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  • PATRIC: UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)
  • TUBERCULIST: Probable UDP-N-acetylmuramoylalanine-D-glutamate ligase MurD
  • NCBI: Probable UDP-N-acetylmuramoylalanine-D-glutamate ligase MurD
  • updated information (H37Rv4):
    • gene name: murD
    • function:
    • reference:
• Type: Not Target
• Start: 2414934
• End: 2416394
• Operon:


• Trans-membrane region:
  
• Role: II.C.3 - Murein sacculus and peptidoglycan
• GO terms:
  • GO:0071555 - cell wall organization (Uniprot)
  • GO:0051301 - cell division (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016874 - ligase activity (Uniprot)
  • GO:0009252 - peptidoglycan biosynthetic process (Uniprot)
  • GO:0009058 - biosynthetic process (Uniprot)
  • GO:0008764 - UDP-N-acetylmuramoylalanine-D-glutamate ligase activity (Uniprot)
  • GO:0008360 - regulation of cell shape (Uniprot)
  • GO:0007049 - cell cycle (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + DGLU[c] + UDP_91_NAM_58_NGM_93_ALA[c] -> ADP[c] + PI[c] + UDP_91_NAM_58_NGM_93_ALAGLU[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on murD:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -5.543 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VLDPLGPGAPVLVAGGRVTGQAVAAVLTRFGATPTVCDDDPVMLRPHAERGLPTVSSSDAVQQITGYALVVASPGFSPATPLLAAAAAAGVPIWGDVELA
WRLDAAGCYGPPRSWLVVTGTNGKTTTTSMLHAMLIAGGRRAVLCGNIGSAVLDVLDEPAELLAVELSSFQLHWAPSLRPEAGAVLNIAEDHLDWHATMA
EYTAAKARVLTGGVAVAGLDDSRAAALLDGSPAQVRVGFRLGEPAARELGVRDAHLVDRAFSDDLTLLPVASIPVPGPVGVLDALAAAALARSVGVPAGA
IADAVTSFRVGRHRAEVVAVADGITYVDDSKATNPHAARASVLAYPRVVWIAGGLLKGASLHAEVAAMASRLVGAVLIGRDRAAVAEALSRHAPDVPVVQ
VVAGEDTGMPATVEVPVACVLDVAKDDKAGETVGAAVMTAAVAAARRMAQPGDTVLLAPAGASFDQFTGYADRGEAFATAVRAVIR

Additional Information