Rv2152c (murC)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: UDP-N-acetylmuramate-L-alanine ligase
- REFSEQ: UDP-N-acetylmuramate--L-alanine ligase
- PATRIC: UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)
- TUBERCULIST: Probable UDP-N-acetylmuramate-alanine ligase MurC
- NCBI: Probable UDP-N-acetylmuramate-alanine ligase MurC
- updated information (H37Rv4):
  - gene name: murC
  - function:
  - reference:
Type: Not Target
Start: 2410638
End: 2412122
Operon:

Trans-membrane region:
Role: II.C.3 - Murein sacculus and peptidoglycan
GO terms:
- GO:0071555 - cell wall organization (Uniprot)
- GO:0051301 - cell division (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016874 - ligase activity (Uniprot)
- GO:0009252 - peptidoglycan biosynthetic process (Uniprot)
- GO:0009058 - biosynthetic process (Uniprot)
- GO:0008763 - UDP-N-acetylmuramate-L-alanine ligase activity (Uniprot)
- GO:0008360 - regulation of cell shape (Uniprot)
- GO:0007049 - cell cycle (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0005524 - ATP binding (Uniprot)
- GO:0000166 - nucleotide binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- ATP[c] + ALA[c] + 0.3 UDPNAM[c] + 0.7 UDPNGM[c] <=> ADP[c] + PI[c] + UDP_91_NAM_58_NGM_93_ALA[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
7BVB	99%	Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)	Crystal structure of UDP-N-acetylmuramic Acid L-alanine ligase (MurC) from Mycobacterium bovis in complex with UDP-N-acetylglucosamine
7BVA	99%	Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)	Crystal structure of UDP-N-acetylmuramic Acid L-alanine ligase (MurC) from Mycobacterium bovis
5VVW	40%	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	Structure of MurC from Pseudomonas aeruginosa
1P3D	38%	Haemophilus influenzae	Crystal Structure of UDP-N-acetylmuramic acid:L-alanine ligase (MurC) in Complex with UMA and ANP.
1P31	38%	Haemophilus influenzae	Crystal Structure of UDP-N-acetylmuramic acid:L-alanine Ligase (MurC) from Haemophilus influenzae
1GQY	38%	HAEMOPHILUS INFLUENZAE	MURC - CRYSTAL STRUCTURE OF THE ENZYME FROM HAEMOPHILUS INFLUENZAE COMPLEXED WITH AMPPCP
1GQQ	38%	HAEMOPHILUS INFLUENZAE	MURC - Crystal structure of the apo-enzyme from Haemophilus influenzae
6X9N	37%	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	Pseudomonas aeruginosa MurC with AZ5595
6X9F	37%	Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)	Pseudomonas aeruginosa MurC with AZ8074
4HV4	37%	Yersinia pestis	2.25 Angstrom resolution crystal structure of UDP-N-acetylmuramate--L-alanine ligase (murC) from Yersinia pestis CO92 in complex with AMP

Links to additional information on murC:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -8.17 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VSTEQLPPDLRRVHMVGIGGAGMSGIARILLDRGGLVSGSDAKESRGVHALRARGALIRIGHDASSLDLLPGGATAVVTTHAAIPKTNPELVEARRRGIP
VVLRPAVLAKLMAGRTTLMVTGTHGKTTTTSMLIVALQHCGLDPSFAVGGELGEAGTNAHHGSGDCFVAEADESDGSLLQYTPHVAVITNIESDHLDFYG
SVEAYVAVFDSFVERIVPGGALVVCTDDPGGAALAQRATELGIRVLRYGSVPGETMAATLVSWQQQGVGAVAHIRLASELATAQGPRVMRLSVPGRHMAL
NALGALLAAVQIGAPADEVLDGLAGFEGVRRRFELVGTCGVGKASVRVFDDYAHHPTEISATLAAARMVLEQGDGGRCMVVFQPHLYSRTKAFAAEFGRA
LNAADEVFVLDVYGAREQPLAGVSGASVAEHVTVPMRYVPDFSAVAQQVAAAASPGDVIVTMGAGDVTLLGPEILTALRVRANRSAPGRPGVLG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999700; 14 non-insertions in a row out of 14 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 14 non-insertions in a row out of 14 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 14 non-insertions in a row out of 14 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 14 non-insertions in a row out of 14 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999950; 14 non-insertions in a row out of 14 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.02
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0967 (csoR) (Direct binding)
- Rv1816 (-) (Upstream of operon)
- Rv2887 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)

Property	Value	Creator	Evidence	PMID	Comment
Name	UDP-N-acetylmuramate-alanine ligase	mjackson	IDA		Peptidoglycan precursor synthesis
Citation	N Glycolylation of the nucleotide precursors of peptidoglycan biosynthesis of Mycobacterium spp. is altered by drug treatment. authors,S. Mahapatra,H. Scherman,PJ. Brennan,DC. Crick J. Bacteriol. 2005	jjmcfadden		15774877	Inferred from direct assay
Term	EC:6.3.2.8 UDP-N-acetylmuramate--L-alanine ligase. - NR	jjmcfadden	NR		Inferred from direct assay authors,S. Mahapatra,H. Scherman,PJ. Brennan,DC. Crick N Glycolylation of the nucleotide precursors of peptidoglycan biosynthesis of Mycobacterium spp. is altered by drug treatment. J. Bacteriol. 2005
Citation	N Glycolylation of the nucleotide precursors of peptidoglycan biosynthesis of Mycobacterium spp. is altered by drug treatment. authors,S. Mahapatra,H. Scherman,PJ. Brennan,DC. Crick J. Bacteriol. 2005	extern:JZUCKER		15774877	Inferred from direct assay
Term	EC:6.3.2.8 UDP-N-acetylmuramate--L-alanine ligase. - NR	extern:JZUCKER	NR		Inferred from direct assay authors,S. Mahapatra,H. Scherman,PJ. Brennan,DC. Crick N Glycolylation of the nucleotide precursors of peptidoglycan biosynthesis of Mycobacterium spp. is altered by drug treatment. J. Bacteriol. 2005

TB Genome Annotation Portal