TB Genome Annotation Portal

Rv2145c (wag31)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: antigen 84
  • REFSEQ: hypothetical protein
  • PATRIC: FIG055075: Possibly a cell division protein antigen 84 in Mycobacteria
  • TUBERCULIST: Diviva family protein Wag31
  • NCBI: Diviva family protein Wag31
  • updated information (H37Rv4):
    • gene name: wag31
    • function:
    • reference:
• Type: Not Target
• Start: 2404616
• End: 2405398
• Operon:


• Trans-membrane region:
  
• Role: II.C.2 - Surface polysaccharides, lipopolysaccharides, proteins and antigens
• GO terms:
  • GO:0060187 - cell pole (Uniprot)
  • GO:0051301 - cell division (Uniprot)
  • GO:0050821 - protein stabilization (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0009273 - peptidoglycan-based cell wall biogenesis (Uniprot)
  • GO:0008360 - regulation of cell shape (Uniprot)
  • GO:0007049 - cell cycle (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6LFA	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Structure of the N-terminal domain of Wag31
  2WUK	41%	BACILLUS SUBTILIS	DivIVA N-terminal domain, F17A mutant
  2WUJ	41%	BACILLUS SUBTILIS	DivIVA N-terminal domain

• Links to additional information on wag31:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -11.489 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQA
LKAARVLSLAQDTADRLTNTAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQ
QRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSNADAGGFDQFNRGKN

Additional Information