Rv2142c (parE2)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: toxin
- REFSEQ: hypothetical protein
- PATRIC: FIG00823288: hypothetical protein
- TUBERCULIST: Possible toxin ParE2
- NCBI: Possible toxin ParE2
- updated information (H37Rv4):
  - gene name: parE2
  - function:
  - reference:
Type: Not Target
Start: 2402193
End: 2402510
Operon:

Trans-membrane region:
Role: VI - Unknowns
GO terms:
- GO:0045926 - negative regulation of growth (Uniprot)
- GO:0005515 - protein binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on parE2:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.166 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAIDILAVRHGMENPNAVEAEIS
GRTFE

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 13 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 13 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 13 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 13 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 13 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 2.7
Growth-Advantage	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Inhibits Rv1960c	harsharohiratruefriend	ISA		operon(Functional linkage) authors,K. Simola,RK. Selander,A. de la Chapelle,G. Corneo,E. Ginelli Molecular basis of chromosome banding. I. The effect of mouse DNA fractions on two fluorescent dyes in vitro. Chromosoma 1975
Citation	A conserved mode of protein recognition and binding in a ParD-ParE toxin-antitoxin complex. authors,KM. Dalton,S. Crosson Biochemistry 2010	harsharohiratruefriend	ISA	20143871	operon(Functional linkage)
Interaction	Inhibits Rv1960c	harsharohiratruefriend	ISA		operon(Functional linkage) authors,KM. Dalton,S. Crosson A conserved mode of protein recognition and binding in a ParD-ParE toxin-antitoxin complex. Biochemistry 2010
Citation	New connections in the prokaryotic toxin-antitoxin network: relationship with the eukaryotic nonsense-mediated RNA decay system. authors,V. Anantharaman,L. Aravind Genome Biol. 2003	harsharohiratruefriend	ISA	14659018	operon(Functional linkage)
Interaction	Inhibits Rv1960c	harsharohiratruefriend	ISA		operon(Functional linkage) authors,V. Anantharaman,L. Aravind New connections in the prokaryotic toxin-antitoxin network: relationship with the eukaryotic nonsense-mediated RNA decay system. Genome Biol. 2003
Citation	Prokaryotic toxin-antitoxin stress response loci. authors,K. Gerdes,SK. Christensen,A. Lbner-Olesen Nat. Rev. Microbiol. 2005	harsharohiratruefriend	ISA	15864262	operon(Functional linkage)
Interaction	Inhibits Rv1960c	harsharohiratruefriend	ISA		operon(Functional linkage) authors,K. Gerdes,SK. Christensen,A. Lbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Citation	Molecular basis of chromosome banding. I. The effect of mouse DNA fractions on two fluorescent dyes in vitro. authors,K. Simola,RK. Selander,A. de la Chapelle,G. Corneo,E. Ginelli Chromosoma 1975	harsharohiratruefriend	ISA	50167	operon(Functional linkage)
Symbol	ParE2	jlew			Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Citation	Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009	jlew		19016878	Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
Other	start:2402193	rslayden			Hypothetical unknown protein
Other	stop:2402510	rslayden			Hypothetical unknown protein
Other	strand:+	rslayden			Hypothetical unknown protein

TB Genome Annotation Portal