TB Genome Annotation Portal

Rv2115c (mpa)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: proteasome-associated ATPase
  • REFSEQ: ATPase
  • PATRIC: Bacterial proteasome-activating AAA-ATPase (PAN)
  • TUBERCULIST: Mycobacterial proteasome ATPase Mpa
  • NCBI: Mycobacterial proteasome ATPase Mpa
  • updated information (H37Rv4):
    • gene name: mpa
    • function:
    • reference:
• Type: Essential
• Start: 2374461
• End: 2376290
• Operon:


• Trans-membrane region:
  
• Role: III.C - Cell division
• GO terms:
  • GO:0140035 - ubiquitination-like modification-dependent protein binding (Uniprot)
  • GO:0071732 - cellular response to nitric oxide (Uniprot)
  • GO:0070628 - proteasome binding (Uniprot)
  • GO:0051409 - response to nitrosative stress (Uniprot)
  • GO:0043335 - protein unfolding (Uniprot)
  • GO:0042802 - identical protein binding (Uniprot)
  • GO:0022623 - proteasome-activating nucleotidase complex (Uniprot)
  • GO:0019941 - modification-dependent protein catabolic process (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0010499 - proteasomal ubiquitin-independent protein catabolic process (Uniprot)
  • GO:0010498 - proteasomal protein catabolic process (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0000502 - proteasome complex (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3m9d, 3m91, 3m9h, 3fp9, 3m9b
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5KZF	100%	Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)	Crystal structure of near full-length hexameric Mycobacterium tuberculosis proteasomal ATPase Mpa in apo form
  3M9H	100%	Mycobacterium tuberculosis	Crystal structure of the amino terminal coiled coil domain of the Mycobacterium tuberculosis proteasomal ATPase Mpa
  3M9D	100%	Mycobacterium tuberculosis	Crystal structure of the prokaryotic ubiquintin-like protein Pup complexed with the hexameric proteasomal ATPase Mpa which includes the amino terminal coiled coil domain and the inter domain
  3M9B	100%	Mycobacterium tuberculosis	Crystal structure of the amino terminal coiled coil domain and the inter domain of the Mycobacterium tuberculosis proteasomal ATPase Mpa
  3M91	100%	Mycobacterium tuberculosis	Crystal structure of the prokaryotic ubiquitin-like protein (Pup) complexed with the amino terminal coiled coil of the Mycobacterium tuberculosis proteasomal ATPase Mpa
  3FP9	99%	Mycobacterium tuberculosis	Crystal structure of Intern Domain of proteasome-associated ATPase, Mycobacterium tuberculosis
  5KWA	96%	Mycobacterium tuberculosis	complete structure of the Mycobacterium tuberculosis proteasomal ATPase Mpa
  2WFW	78%	RHODOCOCCUS ERYTHROPOLIS	Structure and activity of the N-terminal substrate recognition domains in proteasomal ATPases - The Arc domain structure
  6J30	46%	Saccharomyces cerevisiae S288c	yeast proteasome in Ub-engaged state (C2)
  6J2X	46%	Saccharomyces cerevisiae S288c	Yeast proteasome in resting state (C1-a)

• Links to additional information on mpa:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.784 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MGESERSEAFGIPRDSPLSSGDAAELEQLRREAAVLREQLENAVGSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSG
YGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDG
LPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPKAEVEDLVLEEVPDVSYADIGGLSRQIEQIRDAVELPFLHKELYREYSLRPPKGVLLYGPPGCGKT
LIAKAVANSLAKKMAEVRGDDAHEAKSYFLNIKGPELLNKFVGETERHIRLIFQRAREKASEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVPQLLSEI
DGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEAAQDIYSKYLTEFLPVHADDLAEFDGDRSACIKAMIEKVVDRMYAEIDDNRFLEVTY
ANGDKEVMYFKDFNSGAMIQNVVDRAKKNAIKSVLETGQPGLRIQHLLDSIVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSSASRAID
TESNLGQYL

Additional Information