Rv2094c (tatA)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: TatA/E family twin arginine-targeting protein translocase
- REFSEQ: twin arginine translocase protein A
- PATRIC: Twin-arginine translocation protein TatA
- TUBERCULIST: Sec-independent protein translocase membrane-bound protein TatA
- NCBI: Sec-independent protein translocase membrane-bound protein TatA
- updated information (H37Rv4):
  - gene name: tatA
  - function:
  - reference:
Type: Not Target
Start: 2353046
End: 2353297
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0040007 - growth (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0015031 - protein transport (Uniprot)
- GO:0009306 - protein secretion (Uniprot)
- GO:0008565 - protein transporter activity (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2MN7	46%	Escherichia coli	Solution structure of monomeric TatA of twin-arginine translocation system from E. coli
2MN6	46%	Escherichia coli	Solution structure of dimeric TatA of twin-arginine translocation system from E. coli
2LZS	46%	Escherichia coli	TatA oligomer
2LZR	46%	Escherichia coli	TatA T22P

Links to additional information on tatA:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -9.301 (from Jeremy Rock's lab)

Amino Acid Sequence

VGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAEASIETPTPVQSQRVDPSAASGQDSTEARPA

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Too-Short	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 2 non-insertions in a row out of 2 sites
Too-Short	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 2 non-insertions in a row out of 2 sites
Too-Short	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 2 non-insertions in a row out of 2 sites
Too-Short	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
Too-Short	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Uncertain	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0081 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Interaction	PhysicalInteraction Rv2525c	kandarpbioinfo	IPI		ChIP (Physical interaction) B. Saint-Joanis, C. Demangel et al. Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv2525c	kandarpbioinfo	IPI		ChIP (Physical interaction) JA. McDonough, JR. McCann et al. Identification of functional Tat signal sequences in Mycobacterium tuberculosis proteins. J. Bacteriol. 2008
Citation	Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. JE. Posey, TM. Shinnick et al. J. Bacteriol. 2006	priti.priety	IDA	16452415	Spectrophotometric Analysis
Interaction	PhysicalInteraction Rv2068c	priti.priety	IDA		Spectrophotometric Analysis JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Citation	The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. JA. McDonough, KE. Hacker et al. J. Bacteriol. 2005	priti.priety	IDA	16267291	Spectrophotometric Analysis
Interaction	PhysicalInteraction Rv2068c	priti.priety	IDA		Spectrophotometric Analysis JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Citation	Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. JE. Posey, TM. Shinnick et al. J. Bacteriol. 2006	ashwinigbhat	IDA	16452415	Spectrophotometric Analysis
Interaction	PhysicalInteraction Rv2068c	ashwinigbhat	IDA		Spectrophotometric Analysis JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Citation	The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. JA. McDonough, KE. Hacker et al. J. Bacteriol. 2005	ashwinigbhat	IDA	16267291	Spectrophotometric Analysis
Interaction	PhysicalInteraction Rv2068c	ashwinigbhat	IDA		Spectrophotometric Analysis JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	Operon Rv1224	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Interaction	Operon Rv1224	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) authors,BC. Berks,F. Sargent,T. Palmer The Tat protein export pathway. Mol. Microbiol. 2000
Interaction	Operon Rv1224	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	RegulatedBy Rv1221	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. PA. Fontn, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008
Interaction	RegulatedBy Rv1221	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. PA. Fontn, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008
Citation	The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. JA. McDonough, KE. Hacker et al. J. Bacteriol. 2005	jlew		16267291	MS deletion mutant. We describe phenotypic analyses of tatA and tatC deletion mutants of M. smegmatis, which demonstrated that tatA and tatC encode components of a functional Tat system.
Citation	Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence. B. Saint-Joanis, C. Demangel et al. J. Bacteriol. 2006	jlew		16952959	essential in Mtb. Saint-Joanis B, Demangel C, Jackson M, Brodin P, Marsollier L, Boshoff H, Cole ST.

TB Genome Annotation Portal