TB Genome Annotation Portal

Rv2069 (sigC)

Amino Acid Sequence

MTATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAIARHVVADHIRHVRSRPRTT
RGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVGTIRSRVARARDALLADAEPDDLTG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 8 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 8 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 8 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 9 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 9 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.54
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2069 (sigC)

    PropertyValueCreatorEvidencePMIDComment
    InteractionTranscription Rv3843cashwinigbhatIEPAffinity purification (Physical interaction)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv3843cashwinigbhatIPIAffinity purification (Physical interaction)
    G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
    InteractionTranscription Rv3843cashwinigbhatIPIAffinity purification (Physical interaction)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv3843cashwinigbhatIPICo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv3843cashwinigbhatIEPAffinity purification (Physical interaction)
    G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
    InteractionTranscription Rv3843cashwinigbhatIEPCo-expression (Functional linkage)
    G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
    InteractionTranscription Rv3843cashwinigbhatIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv3843cashwinigbhatIPICo-expression (Functional linkage)
    G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
    InteractionTranscription Rv3843cpriti.prietyIEPAffinity purification (Physical interaction)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv3843cpriti.prietyIPIAffinity purification (Physical interaction)
    G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
    InteractionTranscription Rv3843cpriti.prietyIPIAffinity purification (Physical interaction)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv3843cpriti.prietyIPICo-expression (Functional linkage)
    G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
    InteractionTranscription Rv3843cpriti.prietyIPICo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv3843cpriti.prietyIEPAffinity purification (Physical interaction)
    G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
    InteractionTranscription Rv3843cpriti.prietyIEPCo-expression (Functional linkage)
    G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
    InteractionTranscription Rv3843cpriti.prietyIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv3482csourish10IEPCo-expression (Functional linkage)
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionTranscription Rv3482csourish10IEPCo-expression (Functional linkage)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    InteractionSignaling Rv3246csourish10IEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv3161cshahanup86IEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv3064cpriydarshinipriyanka2001NASCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv2387sourish10IPIAffinity purification (Physical interaction)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    InteractionRegulatory Rv3246cpriti.prietyIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv0129cpriti.prietyIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    CitationMycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. R. Sun, PJ. Converse et al. Mol. Microbiol. 2004ashwinigbhatIEP15049808Co-expression (Functional linkage)
    InteractionRegulatory Rv2031cashwinigbhatIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv0490ashwinigbhatIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv3246cashwinigbhatIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv0129cashwinigbhatIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    CitationThe Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. J. Lei, H. Zhang et al. Curr. Microbiol. 2005priti.prietyIDA16091848Structural Analysis
    InteractionRegulatory Rv2234priti.prietyIDAStructural Analysis
    J. Lei, H. Zhang et al. The Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. Curr. Microbiol. 2005
    CitationThe Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. J. Lei, H. Zhang et al. Curr. Microbiol. 2005ashwinigbhatIDA16091848Spectrophotometric
    InteractionRegulatory Rv2234ashwinigbhatIDASpectrophotometric
    J. Lei, H. Zhang et al. The Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. Curr. Microbiol. 2005
    CitationThe Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. J. Lei, H. Zhang et al. Curr. Microbiol. 2005ashwinigbhatIDA16091848Structural Analysis
    InteractionRegulatory Rv2234ashwinigbhatIDAStructural Analysis
    J. Lei, H. Zhang et al. The Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. Curr. Microbiol. 2005
    CitationMycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. R. Sun, PJ. Converse et al. Mol. Microbiol. 2004priti.prietyIEP15049808Co-expression (Functional linkage)
    InteractionRegulatory Rv2031cpriti.prietyIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv0490priti.prietyIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    CitationThe Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. J. Lei, H. Zhang et al. Curr. Microbiol. 2005priti.prietyIDA16091848Spectrophotometric
    InteractionRegulatory Rv2234priti.prietyIDASpectrophotometric
    J. Lei, H. Zhang et al. The Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. Curr. Microbiol. 2005
    InteractionRegulatory Rv1523shahanup86IEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionPhysicalInteraction Rv0723anshula.arora1990IPIChIP (Physical Interaction)
    authors,I. Medow,S. Rsch-Gerdes,KH. Schrder Comparison of ribosomes and ribosomal proteins of sensitive and resistant mycobacteria. Zentralbl Bakteriol Mikrobiol Hyg A 1987
    InteractionPhysicalInteraction Rv0723anshula.arora1990IPIChIP (Physical Interaction)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    InteractionTranscription Rv0681sudhakar_dipuIPIChIP (Physical interaction)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    InteractionTranscription Rv0680csourish10IEPAffinity purification (Physical interaction)
    T. Matsuba, Y. Suzuki et al. Association of the Rv0679c protein with lipids and carbohydrates in Mycobacterium tuberculosis/Mycobacterium bovis BCG. Arch. Microbiol. 2007
    InteractionTranscription Rv0680csourish10IEPCo-expression (Functional linkage)
    T. Matsuba, Y. Suzuki et al. Association of the Rv0679c protein with lipids and carbohydrates in Mycobacterium tuberculosis/Mycobacterium bovis BCG. Arch. Microbiol. 2007
    InteractionTranscription Rv0331sourish10IEPCo-expression (Functional linkage)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    InteractionRegulatory Rv0280gaat3sIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionTranscription Rv0108cprabhakarsmailIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv0095cgaurisd10IPIChIP (Physical Interaction)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    InteractionRegulatory Rv0096gaurisd10IPIChIP (Physical Interaction)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    InteractionRegulatory Rv0096gaurisd10IPIChIP (Physical Interaction)
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionInhibitedBy Rv0093cgaurisd10TASIn silico analysis
    KG. Thakur,AM. Joshi,B. Gopal Structural and biophysical studies on two promoter recognition domains of the extra-cytoplasmic function sigma factor sigma(C) from Mycobacterium tuberculosis. J. Biol. Chem. 2007
    InteractionRegulates Rv3584yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3649yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3267yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3314cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3462cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3483cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv2909cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3058cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3064cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv3068cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulates Rv0951yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1593cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1731yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv2031cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv2700yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0144yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0231yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0287yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0643cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0108cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

    Comments